авторефераты диссертаций БЕСПЛАТНАЯ БИБЛИОТЕКА РОССИИ

КОНФЕРЕНЦИИ, КНИГИ, ПОСОБИЯ, НАУЧНЫЕ ИЗДАНИЯ

<< ГЛАВНАЯ
АГРОИНЖЕНЕРИЯ
АСТРОНОМИЯ
БЕЗОПАСНОСТЬ
БИОЛОГИЯ
ЗЕМЛЯ
ИНФОРМАТИКА
ИСКУССТВОВЕДЕНИЕ
ИСТОРИЯ
КУЛЬТУРОЛОГИЯ
МАШИНОСТРОЕНИЕ
МЕДИЦИНА
МЕТАЛЛУРГИЯ
МЕХАНИКА
ПЕДАГОГИКА
ПОЛИТИКА
ПРИБОРОСТРОЕНИЕ
ПРОДОВОЛЬСТВИЕ
ПСИХОЛОГИЯ
РАДИОТЕХНИКА
СЕЛЬСКОЕ ХОЗЯЙСТВО
СОЦИОЛОГИЯ
СТРОИТЕЛЬСТВО
ТЕХНИЧЕСКИЕ НАУКИ
ТРАНСПОРТ
ФАРМАЦЕВТИКА
ФИЗИКА
ФИЗИОЛОГИЯ
ФИЛОЛОГИЯ
ФИЛОСОФИЯ
ХИМИЯ
ЭКОНОМИКА
ЭЛЕКТРОТЕХНИКА
ЭНЕРГЕТИКА
ЮРИСПРУДЕНЦИЯ
ЯЗЫКОЗНАНИЕ
РАЗНОЕ
КОНТАКТЫ


Pages:     | 1 | 2 ||

«ФЕДЕРАЛЬНОЕ БЮДЖЕТНОЕ УЧРЕЖДЕНИЕ НАУКИ ИНСТИТУТ МОЛЕКУЛЯРНОЙ И КЛЕТОЧНОЙ БИОЛОГИИ СИБИРСКОГО ОТДЕЛЕНИЯ РАН на правах ...»

-- [ Страница 3 ] --

Рисунок 12. Схема, отражающая полиморфизм по 164 позиции второго экзона гена FPGT у сибирской косули без В-хромосом, у мазама, на В-хромосомах и у сибирской косули с 8 В-хромосомами.

Таблица 10. Список полиморфизмов во втором экзоне гена FPGT, обнаруженных на В хромосомах, у сибирской косули с 8 В-хромосомами (CPY (8B)), сибирской косули без В-хромосом (CPY (0B)), марала (CEL) и коровы (BTA).

позиция B CPY (8B) CPY (0B) AAL BTA 164 G G/A A A A Среди замен, характерных для парнокопытных, нужно отметить замену пролин31 на серин31. Замена – глутаминовая кислота51 на лизин – высокоспецифична для семейства оленьих, потому как во всем ряду рассмотренных позвоночных вплоть до рептилий в данной позиции встречается глутаминовая кислота. Кроме того, была обнаружена замена аланин42 на валин42 у представителей семейства оленьих. Валин в данной позиции был обнаружен еще у морской свинки, у опоссума, утконоса и анолиса. Замена валин77 на аланин77, встречающаяся у представителей семейства оленьих, обнаружена еще у утконоса и опоссума.

GKSMAAGEFWDIVAITAADEKQELAYKQQLSEKLKKKELPLGVQYHVFVDPAGAKI BTA GKSMAPGEFWDIVVITAADEKQKLAYKQQLSEKLKKKELPLGVQYHVFADPSGARI КДНК KKKELPLGVQYHVFADPSGARI CPY (8B) KKKELPLGVQYHVFADPSGARI В-хромосомы GKSVAPGEFWDIVVITAADEKQKLAYKQQLSEKLKKKELPLGVQYHVFADPSGAKI CPY (0В) GKSVAAGEFWDIVVLTAANEKQKLAYKQQLSEKLKKKELPLGVQYHVFADPPGAKI CEL GKSMAAGEFWDIVVITAANEKQELAYKQQLSEKLKKKELPLGVKYHVFADPPGAKI MGO GKPVAAGEFWDIVAITAADEKQELAYKQQLSDKLKKKELPLGVQYHVFVDPTGAKI VPA GKPVAAGKFWDIVAITAADEKQELAYKQQLSEKLKKKELPLGVQYHVFVDPAGAKI FCA GKPVAAGEFWDIVAITAADEKQELAYKQQLSEKLKKKELPLGVRYHVFVDPAGAKI AME GKPVAPGEFWDIVAITAADEKQELAYKQQLSEKLKRKELPLGVQYHVFVDPAGAKI CFA GKPVAAGEFWDIVAITAADEKQELAYKQQLSEKLKKKELPLGVQYHVFVDPPGAKI ECA GKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKI HSA GKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKI PTR GKVVAPGEFWDIVAITAADEKQELAYNQQLSKKLKRKELPLGVQYHVFVDPAGAKI CJA GKPVAAGEFWDVVAITAADEKQELAYKQQLSEKLKKRELPLGVQYHVFPDPAGTKI MMU GKPVAAGEFWDVVAITAADEKQELAYKQQLSEKLRRKELPLGVQYHVFPDPAGTKI RNO GKPVGTGEFWDVVVLTAADEKQELAYQQQLSEKLKRKELPLGVQYHVFVDPAGSKI CPO GKPVAAGEFWDIVAITAADEKQELAYKQQLSEKMKRKELPLGAQYHVFVDPAGAKI OCU GKPVAAGEFWDIVAITAADERQELAYKQQLSEKLKRRELPLGVQYHVFVDPVGAKI LAF GKTVKPGEFWDAVVITAADEKQESAYQQQLASKLKRKELPLGVHYHVFADPAGTKI OAN GQPVPPGQFWDVVVLTPADGDQEVAYQLQLTRKLQRGELPLGVHYHVFADPTGAKI DVI -------------------AEQERAFRRQLAAKLRGGELPLGVRYHVFVDPPGPKI GGA GKTVQPGEFWDIIVITAVDRKQEIAYQQQLSGKLKRKELPLGVHYHVFVDPPGPKI ACA Рисунок 13. Сравнение аминокислотных последовательностей второго экзона гена FPGT, у представителей семейства оленьих и других охарактеризованных животных.

Черным цветом отмечены значимые замены, описанные в тексте. Серым цветом отмечены замены, встречающиеся у других видов животных относительно замен, рассматриваемых нами. “BTA” – Bos taurus, “CPY” - Capreolus pygargus, “CEL” – Cervus elaphus, “MGO” Mazama gouazoubira, “VPA” Vicugna pacos, “FCA” Felis catus, “AME” Ailuropoda melanoleuca, “CFA” Canis lupus familiaris, “ECA” Equus ferus caballus, “HSA” Homo sapiens, “PTR” Pan troglodytes, “CJA” Callithrix jacchus, “MMU” Mus musculus, “RNO” Rattus norvegicus, “CPO” Cavia porcellus, “OCU” Oryctolagus cuniculus, “LAF” Loxodonta africana, “OAN” Ornithorhynchus anatinus, “DVI” Didelphis virginiana, “GGA” Gallus gallus, “ACA” Anolis carolinensis.

3.5.3 Сравнение третьего экзона гена FPGT в ряду млекопитающих Мы отсеквенировали копии третьего экзона гена FPGT на геномной ДНК сибирской косули с 8 В-хромосомами, сибирской косули без В хромосом, лося, марала и мазама. Нами были обнаружены две аминокислотные замены: серин89 на аланин89 и лизин104 на глутаминовую кислоту104, специфичные для рассмотренных видов семейства оленьих: для сибирской косули с 8 В-хромосомами, для сибирской косули без В хромосом, лося, марала и мазама (Рис.14). Причем замена в аминокислотной последовательности серин89 на аланин89 была обнаружена еще и у утконоса, а также замена лизин104 на глутаминовую кислоту104 была обнаружена у крысы. Кроме того, нужно отметить синонимичный полиморфизм, встречающийся на В-хромосомах и у сибирской косули с В-хромосомами относительно других видов оленьих (таблица 11).

Таблица 11. Полиморфизм в третьем экзоне гена FPGT, обнаруженный на В хромосомах, у сибирской косули с 8 В-хромосомами относительно сибирской косули без В-хромосом (СРУ), марала (CEL), мазама (MGO), лося (AAL) и коровы (BTA).

позиция В CPY (8B) CPY (0B) CEL MGO BTA AAL A/G A/G A A A A A Вышеупомянутые замены являются очень специфичными для семейства оленьих. В случае замены серин89 на аланин89, серин встречается в рассмотренном ряду позвоночных, как в геномах коровы, так и курицы и анолиса за исключением оленьих. В случае замены лизин104 на глутаминовую кислоту104, лизин встречается как у коровы, так и у опоссума, курицы и анолиса за исключением оленьих (Рис. 14).

GNGGSTLCALRCLEKLYGDKWNSFTILLIHS BTA GNGGATLCALRCLEKLYGDEWNSFTILLIHS CPY (8B) GNGGATLCALRCLEKLYGDEWNSFTILLIHS CPY (0B) GNGGATLCALRCLEKLYGDEWNSFTILLIHS MGO GNGGATLCALRCLEKLYGDEWNSFTILLIHS AAL GNGGATLCALRCLEKLYGDEWNSFTILLIHS CEL GNGGSTLCALRHLEKLYGDEWNSFTILLIHS VPA GNGGSTLCALRCLEKLYEDKWNSFTILLIHS CPO GNGGSTLCALRCLEKLYGDKWNSFTILLIHS ECA GNGGSTLCALRCLEKLYGDKWNSFTILLIHS AME GNGGSTLCALQCLEKLYRDKWNSFTILLIHS CJA GNGGSTLCALQCLEKLYGDKWNSFTILLIHS HAS GNGGSTLCALQCLEKLYGDKWNSFTILLIHS PTR GNGGSTLCSLQCLESLYGDEWNSFKVLLIHS RNO GNGGSTLCSLECLESLCGDKWNSLKVLLIHS MMU GNGGSTLCALQHLEEIYGEMWSSFTILLIHS DVI GNGGSTLCALQCLENLYGDKWNSFTILLIHS LAF GNGGATLCALQRLEELHRDKWNCFTILLIHS OAN GNGGSTLHVLQCLEEHYDDKWDSLTVLLIHS ACA GNGGSTLHVLQCLENLYGDKWTSFIVLLIHS GGA Рисунок 14. Сравнение аминокислотных последовательностей третьего экзона гена FPGT, у представителей семейства оленьих и других охарактеризованных животных.

Черным цветом отмечены значимые замены, описанные в тексте. Серым цветом отмечены замены, встречающиеся у других видов животных относительно замен, рассматриваемых нами. “BTA” – Bos taurus, “CPY” Capreolus pygargus, “CEL” – Cervus elaphus, “MGO” Mazama gouazoubira, “AAL” – Alces alces, “VPA” Vicugna pacos, “AME” Ailuropoda melanoleuca, “ECA” Equus ferus caballus, “HSA” Homo sapiens, “PTR” Pan troglodytes, “CJA” Callithrix jacchus, “MMU” Mus musculus, “RNO” Rattus norvegicus, “CPO” Cavia porcellus, “LAF” Loxodonta africana, “OAN” Ornithorhynchus anatinus, “DVI” Didelphis virginiana, “GGA” Gallus gallus, “ACA” Anolis carolinensis.

3.5.4 Сравнение четвертого экзона гена FPGT в ряду млекопитающих Мы отсеквенировали копии четвертого экзона гена FPGT у сибирской косули с добавочными хромосомами, у европейской косули и марала. У сибирской и европейской косули было найдено семь видоспецифичных замен, относительно рассмотренного ряда позвоночных: треонин165 на серин165, изолейцин175 на треонин175, глутаминовая кислота177 на аспарагиновую кислоту177, фенилаланин248 на лейцин248, лизин279 на серин279 пролин393 на серин393, треонин468 на аланин468, лейцин589 на метионин589 (Рис.16). Данные замены обозначены на рисунке 15 черным цветом. Кроме того, нами была обнаружена одна замена специфичная только для европейской косули валин199 на изолейцин199 (Рис.15). Также была найдена замена, специфичная только для сибирской косули с добавочными хромосомами (гистидин225 на аргинин225) и одна замена, специфичная для марала (серин594 на пролин594), относительно европейской и сибирской косули (Рис.15). В одной позиции в экзоне был найден синонимичный полиморфизм у сибирской косули: пик, соответствующий цитозину, совпадает с пиком, соответствующим тимину, тогда как у европейской косули, марала и коровы в данной позиции наблюдается пик, соответствующий только цитозину. Кроме того, был обнаружен ряд замен, характерных для сибирской косули, европейской косули и марала: аспарагин247 на лизин247, лизин290 на глутамин290, серин321 на лейцин321, серин371 на глицин371, изолейцин384 на валин384, аланин414 на лизин414, треонин522 на серин522 (Рис.15).

HAS GYSQRLPNASALGKIFTALPLGNPIYQMLELKLAMYIDFPLNMNPGILVTCADDIELYSIGEFEFIRFDKPGFTAL ECA GYSQRLPNASALGKIFTALPFGNPIYQMLELKLAMYIDFPSHMNPGILVTCADDIELYSVGESEFIRFDKPGFTAL SSC GYSQRLPNASALGKIFTALPFGSPIYQMLELKLAMYIDFPSHMNPGILVTCADDIELYSIGESEFIRFDKPGFTAL VPA GYSQRLPNASALGKIFTALPLGSPIYQMLELKLAMYIDFPSHMNPGILVTCADDIELYSTGESEFIRFDKPGFTAL BTA GYSQRLPSASALGKIFTALPFGSPIYQMLELKLAMYIDFPSHMNPGILITCADDIELYSIGESEFIRFDKPGFTAL CEL GYSQRLPSASALGKIFTALPFGSPIYQMLELKLAMYIDFPSHMNPGILITCADDIELYSIGESEFIRFDKPGFTAL CCA GYSQRLPSASALGKIFTALPFGSPIYQMLELKLAMYIDFPSHMNPGILISCADDIELYSTGDSEFIRFDKPGFTAL CPY(8B) GYSQRLPSASALGKIFTALPFGSPIYQMLELKLAMYIDFPSHMNPGILISCADDIELYSTGDSEFIRFDKPGFTAL AHPSSLTIGTTHGVFVLDPFDDLKHRDLEYRSCHRFLHKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYV AHPSSLTIGTTHGVFVLEPCNYLEYGDLEYRCCHCFLHKPSIEKMHQFGAVCRRGNFSQQAFVRDDIPSLKVDPEYV AHPSSLTVGTTHGVFVLEPFNRLEYRDLEYRCCHRFLHKPSIEMMYKFDAVCRPGNFSQQDFGGGDTPSLKLDPEYV AHPSSLTVGTTHGVFVLEPFDYLGYRDLEYRCCHRFLHKPSIEKMYEFGAVCRPGSFLQQDLAGGDTPSLKLDPGYV AHPSSLTVGTTHGVFVLEPCNHLEYRDLEYRSCHRFLHKPSVEEMYEFDAVCRPRNFFQQEFAGSDIPSLKLEPEYV AHPSSLTVGTTHGVFVLEPFNHLEYRDLEYRSCHRFLHKPSIEEMYEFDAVCRPRKFFQQGFAGSDIPSLKLEAEYV AHPSSLTIGTTHGVFVLEPFNHLEYRDLEYRSCHRFLHKPSIEEMYEFDAVCRPRKLFQQGFAGSDIPSLKLEAEYV AHPSSLTVGTTHGVFVLEPFNHLEYRDLEYRSCRRFLHKPSIEEMYEFDAVCRPRKLFQQGFAGSDIPSLKLESEYV YTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVIKEESELVEMRQRIFHLLKGTS YTDSLFYMDQKSAKKLLAFYEKIGTLSCEIDAYGDFLQALGPGATVEYTRNTSNVTKEESELVDVRQRIFHLLKGTS YTDSVFYMDHKTAKKLLAFYEKIDTLNCEIDAYGDFLQALGPGATVEYTRNTSNVTKEESELVDMRQRIFHLLKGTP YTDSLFYMDHKSARKLLTFYEKIGTLNCEIDAYGDFLQALGPGATVEYTRNTSNVTKEESELVDMRQRIFHLLKGTA YTDSLFYMDHKTAKKLLAFYEKIGTLHCEIDAYGDFLQALGPGATVEYTKNTSNVTKEESELVDMRQRIFHLLKGTP YTDSLFYMDHKTARKLLAFYEQIGTLHCEIDAYGDFLQALGPGATVEYTKNTLNVTKEESELVDMRQRIFHLLKGTP YTDSLFYMDHSTAKKLLAFYEQIGTLHCEIDAYGDFLQALGPGATVEYTKNTLNVTKEESELVDMRQRIFHLLKGTP YTDSLFYMDHSTAKKLLAFYEQIGTLHCEIDAYGDFLQALGPGATVEYTKNTLNVTKEESELVDMRQRIFHLLKGTP LNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIPECSGKTSCIIQSILDSRCSVAPGSVVEYS LNVVVLNNSKFYHIGTTEEYLFHFTSDSSLKSELGLQSLAFSIFPAVPECSGNTSCIIQSILDSRCSVAPGSVVEYS LNVIVLNNSKFYHIGTTKEYLFHFTSDSSLKSELGLQSIAFSIFPAIPEYSGNKSCIIQSILDSRCSLAPGSVVEYS LNVVVLNNSKFYHIGTTEEYLFHFTSDGSLKSELGLQSIAFSIFPAIPECSNNKSCIIQSILDSRCSVASGSVVEYS LNVVVLNNSKFYHIGTTEEYLFHFTADSSLKSELGLQSIAFSLFPSIPECSTNKPCIIQSILDSTCSVTPGSVVEYS LNVVVLNNSKFYHIGTTKEYLFHFTGDSSLKSELGLQSVAFSLFPSIPECSTNKPCIIQSILDSTCSVKPGSVVEYS LNVVVLNNSKFYHIGTTEEYLFHFTGDSSLKSELGLQSVAFSLFPSISECSTNKPCIIQSILDSTCSVKPGSVVEYS LNVVVLNNSKFYHIGTTEEYLFHFTGDSSLKSELGLQSVAFSLFPSISECSTNKPCIIQSILDSTCSVKPGSVVEYS RLGPDVSVGENCIISGSYILTKAALPAHSFVCSLSLKMNRCLKYATMAFGVQDNLKKSVKTLSDIKLLQFFGVCFLS RLGPDVSVGENCIISGSHIVTTAVLPAYSFVCSLSLKMNGHLKYSTMAFGVQDNLKKNVKTLSDIKLLQFFGVCFLS RLGPDVSVGENCIISGSHIITRAILPAYSFVCSLSLKINGHIKYSTMACGVQDNLKKNVKTLSDVKLLQFFGVSLLS RLGPDVSVGENCIISGSYIITTAALPAYSFVCSLSLKMNGHLKYSTMAYGVQDNLKKNVKTLSDIKLLQFFGVCFLS RLGPDVSVEENCIISGAYVKTTAVLPAYSFVCSLSLKMNGHLKYSTMACGVQDNLKKNVKTLSDVKLLQFFGVCFLS RLGPDVSVGENCIISGAYVKTTAVLPAYSFVCSLSLKMNGHLKYSTMACGVQDNLKKNVKTLSDVKVLQFFGVCLLS RLGPDVSVGENCIISGAYIKTTAVLPAYSFVCSLSLKMNGHLKYSAMACGVQDNLKKNVKTLSDVKLLQFFGVCLLS RLGPDVSVGENCIISGAYVKTTAVLPAYSFVCSLSLKMNGHLKYSAMACGVQDNLKKNVKTLSDVKLLQFFGVCLLS CLDVWNLKVTEELFSGNKTCLSLWTARIFPVCSSLSDSVITSLKMLNAVKNKSAFSLNSYKLLSIEEMLIYKDVEDM CLDIWNLKITEELFSGNKTCLSLWNARIFPVCSSLSDSFTTSLKMLNAVQNKSTFSLNNYKLLSIEEMLVYKDVEDM CLDVWNLEVTEELFSGNKTCLSLWNARIFPVCSSLSDSVIASLKMLNAVQSKSVFSLNNYKLLSIEEMLVYKDVEDM CLDTWNLKVTEELFSGNKTCLSLWNARIFPVCSSLSDSVTTSLKMLNAVQNKLTFSLSSYKLMSIEEMLAYKDVEDM CLDIWNLKVTEELFSGNKTCLSLWNARIFPVCSSLSDSVTTSLKMLNAVQSKSAFSLNNYKLLSIEEMLFYKDIEDM CLDIWNLKVTEELFSGNKSCLSLWNARIFPVCSSLSDSVTTSLKMLDAVQNKSTFSLNNYKLLSIEEMLFYKDVEDM CLDIWNLKVTEELFSGNKSCLSLWNARIFPVCSSLSDSVTTSLKMLNAVQNKSTFSLNNYKLLSIEEMLFYKDVEDM CLDIWNLKVTEELFSGNKSCLSLWNARIFPVCSSLSDSVTTSLKMLNAVQNKSTFSLNNYKLLSIEEMLFYKDVEDM ITYREQIFLEISLKSSLM ITYREQIFLEITLNRK* ITYREQIFLEIALNRKQS ITYREKIFLEITLN ITYREQIFLEITLNRKQS ITYREQISLEITLNRKQPDLETSY* ITYREQISLEITMNRKQSDLETSY* ITYREQISLEITMNRKQSDLETSY* Рисунок 15. Сравнение аминокислотных последовательностей четвертого экзона гена FPGT у представителей семейства оленьих и других охарактеризованных животных.

Черным цветом отмечены значимые замены, описанные в тексте. Серым цветом отмечены замены, встречающиеся у других видов животных относительно замен, рассматриваемых нами. “BTA” – Bos taurus, “CPY” – Capreolus pygargus, “CEL” – Cervus elaphus, “CCA” – Capreolus capreolus, “SSC” – Sus scrofa, “VPA” – Vicugna pacos, “ECA” – Equus ferus caballus, “HSA” – Homo sapiens.

3.5.5 Сравнение промоторной области гена TNNI3K у оленьих Мы отсеквенировали копии промоторной области гена TNNI3K у европейской косули, сибирской косули с В-хромосомами, у марала и лося.

На В-хромосомах и у сибирской косули с В-хромосомами были обнаружены полиморфные участки, которые на рисунке 16 обозначены “N” и приведены в таблице 12. Нуклеотидные различия между копиями этого фрагмента были выявлены у коровы и оленьих в одиннадцати позициях. Были обнаружены следующие трансверсии у европейской косули, у сибирской косули с 8 В-хромосомами и на В-хромосомах: (AT), (AC), (TA), (CG) и транзиции: (GA), (AG), (CT). А также была обнаружена одна нуклеотидная замена: транзиция (GA), специфичная только для европейской косули (Рис.16).

Таблица 12. Полиморфизмы в промоторной области гена TNNI3K, обнаруженные у сибирской косули с 8 В-хромосомами (СРУ) и на В-хромосомах относительно европейской косули (ССА), марала (CEL), лося (AAL) и коровы (BTA).

позиция B CPY (8B) CCA AAL CEL BTA 44 C/T C/T C C C C 186 C/T T/C C C C C 188 C/T C/T T T T T BTA TAATTCCTTTCATGATTTCACCCTTGAAACCACAAACTATTTAGTTCTTTGTAATTG CCA TTTTTCCTTTCATGATTTCACCCTTGAAACCACAAACTATTTTGTTCTTTGTCATTG CPY (8B) TTTTTCCTTTCATGATTTCACCCTTGAAACCACAAACTATTTTGTTNTTTGTCATTG B TTTTTCCTTTCATGATTTCACCCTTGAAACCACAAACTATTTTGTTNTTTGTCATTG TTGCATGACATTCCATTTGGCAGTCAGCTTATTTTTAGCCAGACTATCAAAGTATTTTTC TTGCATGGCATTCCATTTGGCAGTCAGCTTATTTTTAGCCAGACTATCAAAAGTATTTTT TTGCATGGCATTCCATTTGGCAGTCAGCTTATTTTTAGCCAGACTATCAAAAGTATTTTT TTGCATGGCATTCCATTTGGCAGTCAGCTTATTTTTAGCCAGACTATCAAAAGTATTTTT CAACTGGACTGTCACTGCACTTGTACTTGGAATCTTGCAACCTCAGGAACTGCACTG CAACTGGACTGTCACTGCACTTAAACTTGGAATCTTGCAACCTGAGGAACTGCGCTG CAACTGGACTGTCACTGCACTTAAACTTGGAATCTTGCAACCTGAGGAACTGCGCTG CAACTGGACTGTCACTGCACTTAAACTTGGAATCTTGCAACCTGAGGAACTGCGCTG GGGAAAAGAAGAAACTTCTAACAAATGGGAAATTATAAATCCAGACCAACGCAAACTTGTACTG GGGAAAAGAAGAAACTTCTAACAAATGGGAAATTGTAAATCCAGACCAAC GGGAAAAGAAGAAANTNCTAACAAATGGGAAATTATAAATCCAGACCAACGCAAACG GGGAAAAGAAGAAANTNCTAACAAATGGGAAATTATAAATCCAGACCAACGCA Рисунок 16. Сравнение нуклеотидных последовательностей промоторной области гена TNNI3K у сибирской косули, европейской косули, на В-хромосомах и у коровы. Черным цветом отмечены значимые замены, описанные в тексте. Серым цветом отмечены замены, встречающиеся у других видов животных относительно замен, рассматриваемых нами. “BTA” – Bos taurus, “CPY” – Capreolus pygargus, “CCA” – Capreolus capreolus. “B” – В-хромосомы. “N” – полиморфные участки.

3.5.6 Сравнение первого экзона гена TNNI3K у оленьих Мы отсеквенировали копию первого экзона гена TNNI3K у европейской косули, сибирской косули с 8 В-хромосомами и у марала (Рис.

В исследуемом экзоне была обнаружена одна нуклеотидная 17).

синонимичная замена (АG), специфичная для оленьих относительно коровы (Рис. 18). В целом, данный экзон у рассмотренных нами видов очень консервативен относительно других экзонов, где различия в аминокислотной последовательности наблюдаются между близкородственными видами.

DEWKKKVSESYVIVIERLEDDLQIKEKELTELRHIFG BTA DEWKKKVSESYVIVIERLEDDLQI КДНК DEWKKKVSESYVIVIERLEDDLQIKEKELTELRHIFG CCA DEWKKKVSESYVIVIERLEDDLQIKEKELTELRHIFG CPY (8B) DEWKKKVSESYVIVIERLEDDLQIKEKELTELRHIFG CEL Рисунок 17. Сравнение аминокислотных последовательностей первого экзона гена TNNI3K у сибирской косули, европейской косули, марала, на В-хромосомах и у коровы.

“BTA” – Bos taurus, “CPY” Capreolus pygargus, “CCA” – Capreolus capreolus, “CEL” – Cervus elaphus.

CPY(8B) CCAAATATATGCCTCAGTTCTGTAAGTTCTTTTTCTTTGATCTGCAGGTCATCTTCTAAT ||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| BTA CCAAATATATGCCTCAGTTCTGTAAGTTCTTTTTCTTTGATCTGCAGATCATCTTCTAAT CTTTCTATTACAATAACATAAGATTCACTGACTTTCTTCTTCCATTCATC |||||||||||||||||||||||||||||||||||||||||||||||||| CTTTCTATTACAATAACATAAGATTCACTGACTTTCTTCTTCCATTCATC Рисунок 18. Сравнение нуклеотидных последовательностей первого экзона гена TNNI3K у сибирской косули и у коровы. “BTA” – Bos taurus, “CPY” Capreolus pygargus.

3.6 Обнаружение транскрипционной активности копии гена FPGT, расположенного на В-хромосомах Как было показано ранее, мы обнаружили две В-хромосом специфичные замены. Причем, одна из замен, во втором экзоне гена FPGT (AG), встречалась только в В-хромосом-специфичной кДНК, на В хромосомах и у сибирской косули с 8 В-хромосомами относительно целого ряда млекопитающих (глава 3.5.2). Поскольку данная замена оказалась характерна для кДНК, стало ясно, что копия гена FPGT с В-хромосом транскрибируется. Однако для полного подтверждения данной гипотезы осталось исключить наличие данной мутации в аутосомной копии гена сибирской косули. Для этого у одного и того же животного сибирской косули с 8 В-хромосомами зав. лаборатории сравнительной геномики В.А.

Трифоновым были микродиссектированы CPY1 и добавочные хромосомы.

В результате секвенирования четырех последовательностей исследуемого нами района хромосомы 1 сибирской косули в искомой позиции был обнаружен аденин, как и у целого рассмотренного нами ранее ряда млекопитающих. Тогда как в результате секвенирования трех последовательностей исследуемого нами района добавочных хромосмом в искомой позиции был обнаружен гуанин, как и в В-хромосом-специфичной кДНК. Таким образом, было показано, что данный район транскрибируется не с аутосом, а с В-хромосом.

Другая В-хромосом-специфичная замена (GA) была обнаружена во втором экзоне гена LRRIQ3. Для того чтобы проверить гипотезу о транскрипционной активности копии этого гена, расположенного на добавочных хромосомах, мы получили последовательность исследуемого нами участка с В-хромосом-специфичной кДНК и тотальной кДНК, выделенной из культуры клеток фибробластов сибирской косули с 8 В хромосомами. Последовательности В-хромосом-специфичной кДНК и тотальной кДНК, полученные со второго экзона гена LRRIQ3, оказались гомологичны последовательности второго экзона гена LRRIQ3, синтезированной с DOP-библиотеки В-хромосом (JN871295). В В хромосом-специфичной и тотальной кДНК в искомой позиции был обнаружен аденин, также как и на В-хромосомах. Это говорит в пользу транскрипционной активности копии гена LRRIQ3, расположенного на В хромосомах. Однако не искючена возможность того, что данная мутация присутствует в аутосомной копии данного гена. Поэтому необходимы дальнейшие исследования этого вопроса.

4. Заключение Картирование В-хромосом сибирской косули показало, что на добавочных элементах присутствует крупный аутосомный сегмент, содержащий ряд уникальных генов. Эти данные согласуются с результатами, полученными на других видах позвоночных: у хищных, у амазонской моллинезии Poecilia formosa (Cyprinodontiforme, Poecillidae) и у эндемичного вида цихлид озера Виктория. Кроме аутосомных копий генов или их фрагметов, на добавочных элементах присутствуют протяженные области, прилегающие к этим генам. Участки, картированные нами на В хромосомах, имеют значительное сходство с гомологичными участками ДНК аутосом косули. В связи с этим можно заключить, что В-хромосомы представляют собой сегментные дупликации генома. Дуплицированные гены на В-хромосомах могут накапливать мутации (как было нами обнаружено в случае фрагмента второго экзона гена LRRIQ3 и второго экзона гена FPGT), что теоретически может приводить к возникновению новых функций этих генов, кроме того, возможно смешение доменов ранее не связанных генов и образование новых комбинаций геномных сегментов.

Таким образом, добавочные элементы служат дополнительным источником новых вариантов кодирующих последовательностей и являются “горячими точками” эволюции. Эти данные становятся особенно важными в свете возможности транскрипции новых вариантов генов с В-хромосом. Известно, что сегментные дупликации обладают рядом общих закономерностей. В большинстве случаев сегментные генные дупликации располагаются тандемно. Со временем, дуплицированные копии перемещаются в другие районы хромосом. Кроме того, большинство генов дуплицируются полностью или частично, представляя собой часть больших дуплицированных сегментов. Особенно интересным является то, что гены с частично дуплицированным кодирующим районом могут быть функциональными. В нашем случае при оценке копийности одного из экзонов гена FPGT у европейской косули без В-хромосом мы обнаружили дупликацию этого экзона. Таким образом, можно предположить, тандемное расположение дуплицированных сегментов у европейской косули с последующей интеграцией одного из сегментов в добавочные хромосомы, часто образующиеся при видообразовании, которое в большинстве случае происходит по районам, содержащим сегментные дупликации.

Гены TNNI3K, FPGT и LRRIQ3, локализованные на добавочных хромосомах, играют важную функциональную роль в жизнедеятельности организма. Известно, что продукт гена FPGT участвует в утилизации фукозы моносахарида, формирующего существенную часть сложных углеводов, гликолипидов и гликопротеинов. Продукт гена TNNI3K участвует в регулировании клеточного роста, пролиферации и дифференциации кардиомиоцитов. Кроме того, продукт гена TNNI3K предотвращает инфаркт миокарда путем подавления апоптоза за счет фосфорилирования белков р38 и и ускоряет созревание JNK кардиомиоцитов на ранних стадиях дифференциации. Также известно, что повышенная экспрессия гена TNNI3K у исследованных организмов не приводит к развитию кардиомиопатии. В связи с этим, особенно интересным оказалось обнаружение экспрессии копии гена FPGT, локализованного на В-хромосомах и появились весомые доказательства в пользу транскрипционной активности гена LRRIQ3. Кроме того, в результате альтернативного сплайсинга генов FPGT и TNNI3K, могут возникать различные варианты транскриптов, оказывающих то или иное важное влияние на функционирование организма. Однако в первом экзоне гена FPGT, в первой аминокислотной позиции на В-хромосомах была выявлена замена метионин1 на валин1 относительно рассмотренного ряда позвоночных. Тогда как у европейской косули в этой позиции присутствовал полиморфизм, что может говорить о наличие псевдогена.

Триплет GTG, кодирующий валин, в стартовой позиции дуплицированного гена FPGT, расположенного на В-хромосомах, может говорить о низкой степени экспрессии этого гена с добавочных хромосом или об образовании усеченной формы белка (Reddy et al., 1985;

Revay et al., 2012).

В данном исследовании мы показали, что уникальные аутосомные гены могут транскрибироваться с В-хромосом. Это может, как было сказано выше, оказывать огромное влияние на функционирование организма за счет повышения дозы гена и образования новых вариантов транскриптов.

Однако в клетке существуют механизмы, частично нивелирующие влияние на фенотип дополнительных транскриптов, считывающихся с добавочных хромосом и обеспечивающих взаимодействие В-хромосом-специфичных и А-хромосом-специфичных транскриптов. В первую очередь транскрипционная активность генов с добавочных хромосом может регулироваться siRNA, которые понижают экспрессию специфичных генов за счет, например, модификации хроматина (Filipowicz et al., 2005). Также В-хромосом-специфичные транскрипты могут вести себя подобно транскриптам с псевдогенов, регулируя экспрессию генов. Транскрипты с В-хромосом-специфичных и А-хромосом-специфичных генов могут формировать регуляторные пары, которые воздействуют друг на друга, за счет изменения уровня экспрессии при участии регуляторных факторов или, например, miRNA (Pink et al., 2011).

Секвенирование и сравнение копий генов, представленных на В хромосомах и аутосомах представителей семейства оленьих, показало, что копии генов, локализованные на добавочных хромосомах сибирской косули, имеют высокую степень гомологии с аутосомными копиями лося, марала, мазама и европейской косули. Эти данные говорят о недавнем происхождении добавочных хромосом от хромосомы 1 сибирской косули.

Использованные нами подходы для картирования В-хромосом – локализация ВАС клонов, ПЦР-картирование, ПЦР в реальном времени по отдельности не дают исчерпывающего ответа на вопрос о локализации аутосомных генов на добавочных элементах. Однако обнаруженные нами В-хромосом-специфичные замены являются гармоничным примером, точно доказывающим локализацию аутосомных генов на добавочных элементах, и подтверждающим правомерность примененных нами подходов, которые, в свою очередь, также не противоречат друг другу, а дополняют и говорят в пользу полученных нами данных. Помимо всего прочего, пример В хромосом-специфичных замен указывает на правомерность использования DOP-библиотеки В-хромосом в нашем исследовании в качестве ключевого объекта и говорит о ее значительной степени представленности.

5. Выводы 1. Кариотип сибирской косули является очень консервативным и представляет собой сохранившийся предковый кариотип семейства оленьих. Кариотипы коровы и сибирской косули разделяются восемью перестройками, из них шестью слияниями хромосом в линии косули, одним слиянием в линии коровы и одной инверсией на хромосоме сибирской косули.

2. В-хромосомы сибирской косули содержат копии аутосомных генов TNNI3K, FPGT и LRRIQ3 с прилегающими к ним межгенными областями. Общий размер района, гомологичного участку (74.6 – 76. м.п.н.) хромосомы 3 коровы на добавочных элементах составляет около м.п.н.

3. Копийность участков генов TNNI3K, FPGT и LRRIQ3 коррелирует с числом В-хромосом.

4. Сравнение генов TNNI3K, FPGT у оленьих относительно ряда млекопитающих показало, что данные гены консервативны 5. Показана экспрессия копии гена FPGT-TNNI3K, расположенного на добавочных хромосомах.

Список литературы 1. Беляев Д.К., Волобуев В.Т., Раджабли С.И., Трут Л.Н. Полиморфизм и мозаицизм по добавочным хромосомам у серебристо-черных лисиц // Генетика. – 1974. – Т. 10. – С. 58-67.

2. Борисов Ю.М., Кораблев В.П., Картавцева И.В., Ляпунова Е.А., Воронцов Н.Н. Добавочные хромосомы у крысовидного хомячка и его систематическое положение // II Съезд Териологического общества. – M., 1978. – С. 13-14.

3. Волобуев В.Т., Тимина Н.Ю. Необычайно высокое число В-хромосом и мозаицизм по ним у азиатской лесной мыши Apodemus peninsulae (Rodentia, Muridae) // Цитология и генетика. 1980. Т. 14. С. 43-45.

4. Гилева Е.А. В-хромосомы, необычное наследование половых хромосом и соотношение по полу у Dicrostonyx torquatus Pall. (1779).

// II Докл Акад Наук СССР. – 1973. – Т. 213. – С. 952-955.

5. Гилева Е.А. Противоположные примеры хромосомной эволюции в двух родах леммнгов, Lemmus и Dicrostonyx (Mammalia, Rodentia) // Генетика. – 1983. – Т. 60. – С. 173-179.

6. Графодатский А.С., Шаршов А.А., Шутов В.В. Кариотипические взаимоотношения Cervidae // Зоологический журнал. 1990. Т.

69(4). С. 101-113.

7. Картавцева И.В. Описание В-хромосом в кариотипе полевой мыши Apodemus agrarius. // Цитология и генетика. – 1994. – Т. 28. – С. 96-97.

8. Ковальская Ю.М. В-хромосомы и ХО-самцы узкочерепных полевок Microtus/Stenocranius/gregalis из северной Монголии // Доклады 7-ой Всесоюзной конференции. – Свердловск, 1988. – C. 73-74.

9. Краль Б. Характеристика хромосом некоторых мышевидных грызунов (Muridae) азиатской части СССР // Зоологические листы. –1971. – Т.

20. – С. 331-347.

10.Соколов В.Е., Орлов В.Н., Чудиновская Г.А., Данилкин А.А.

Хромосомные различия двух подвидов косули - Capreolus capreolus capreolus L и C. c. pygarus Pall // Зоологический журнал. 1978. Т.

52. С. 1109-1112.

11.Соколов В.Е. Приходько В.А. Систематика кабарги (Artiodactyla, Mammalia) // Известия АН. – 1998. – Т. 1. – С. 37-46.

12.Токарская О.Н., Ефремова Д.А., Канн Н.Г., Данилкин А.А., Семпере А., Петросян В.Г., Семенова С.К., Рысков А.П. Вариабельность мультилокусных ДНК маркеров в популяциях сибирской (Capreolus pygargus Pall.) и европейской (C. capreolus L.) косуль // Генетика. – 2000. – Т. 36. – С. 1520-1530.

13.Раджабли С.И., Исаенко А.А., Волобуев В.Т. Исследование природы и роли добавочных хромосом серебристо-черных лисиц. Поведение добавочных хромосом в мейозе // Генетика. – 1978. – Т. 14. – С. 439 443.

14.Andrades-Miranda J., Oliveira L.F.B., Zanchin N.I.T., Mattevi M.S.

Chromosomal description of the rodent genera Oecomys and Nectomys from Brazil // Acta Ther. – 2001. – V. 46. – P. 269–278.

15.Ashman L.K. The biology of stem cell factor and its receptor C kit // Int J Biochem Cell Biol. 1999. V. 31. P. 1037-1051.

16.Avise J.C., Arnold J., Ball R.M., Bermingham E., Lamb T., Neigel J.E., Reeb C.A., Saunders N.C. Intraspecific phylogeography: the mitochondrial DNA bridge between population genetics and systematics // Ann Rev Ecol Syst. 1987. V. 18. P. 489-522.

17.Bailey J.A., Yavor A.M., Massa H.F., Trask B.J., Eichler E.E. Segmental duplications: organization and impact within the current human genome project assembly // Gemone Res. 2001. V. 11. P. 1005-1017.

18.Bailey J.A., Baertsch R., Kent W.J., Haussler D., Eichler E.E. Hotspots of mammalian chromosomal evolution // Genome Biol. – 2004. 5:R23.

19.Balmus G., Trifonov V.A., Biltueva L.S., O’Brien P., Alkalaeva E.S., Fu B., Skidmore J.A., Allen T., Graphodatsky A.S., Yang F., Ferguson-Smith M.A. Cross-species chromosome painting among camel, cattle, pig and human: further insights into the putative Cetartiodactyla ancestral karyotype // Chromosome Res. – 2007. – V. 15. – P. 499-514.

20. Basheva E.A., Torgasheva A.A., Sakaeva G.R., Bidau C., Borodin P.M.

A- and B-chromosome pairing and recombination of the silver fox (Vulpes vulpes L., 1758, Carnivora, Canidae) // Chromosome Res. – 2010. – V. 18.

– P. 689-696.

21.Battaglia E. Cytogenetics of B chromosomes //Caryologia. 1964. V. 17.

P. 245-299.

22.Baverstock P.R., Wats C. H.S., Hogarth J.T. Heterochromatin variation in Australian rodent Uromys caudimaculatus // Chromosoma. 1976. V. 59.

P. 397-403. (Цитировано по Vujosevic, Blagoevic, 2004).

23.Baverstock P.R., Wats C.H.S., Hogarth J.T: Chromosome evolution in Australian rodents. I. The Pseudomyinae, the Hydromyinae and Uromys/Melomys group. // Chromosoma. – 1977. – V. 61. – P. 9–125.

24.Becker D.J., Lowe J.B. Fucose: biosynthesis and biological function in mammals // Glycobiology. – 2003. – V. 13. – P. 41R-53R.

25.Bekasova T.S., Vorontsov N.N. Populational chromosomal polymorphism the Asian forest mouse Apodemus peninsulae // Genetika. – 1975. – V. 11.

– P. 89-94.

26.Bekasova T.S., Vorontsov N.N., Korobitsyina K.V., Korablev V.P. B chromosomes and comparative karyology of the mice of the genus Apodemus // Genetica. 1980. V. 52/53. P. 33-43. (Цитировано по Vujosevic, Blagoevic, 2004).

27.Bel Y., Ferre J., Escriche B. Quantitative real-time PCR with SYBR Green detection to assess gene duplication in insects: study of gene dosage in Drosophila melanogaster (Diptera) and in Ostrinia nubilalis (Lepidoptera) // BMC Res Notes. – 2011. – 4:84.

28.Belcheva R.G., Topashka-Ancheva M.N., Atanassov N. Karyological studies of five species of mammals from Bulgarian fauna // Comptes rendus de l’Academie bulgare des Sciences. – 1988. – V. 42. – P. 125–128.

(Цитировано по Vujosevic, Blagoevic, 2004).

29.Berend S.A., Hale D.W., Engstrom M.D., Greenbaum F.I. Cytogenetics of collared lemmings (Dicrostonyx groenlandicus). Meiotic behavior of B chromosomes suggests a Y-chromosome origin of supernumerary chromosomes // Cytogenet Cell Genet. – 2001. – V. 95. – P. 85-91.

30.Besmer P., Murphy J.E., George P.C., Qiu F.H., Bergold P.J., Lederman L., Snyder H.W.Jr., Brodeur D., Zuckerman E.E., Hardy W.D. A new acute transforming feline retrovirus and relationship of its oncogene v kit with the protein kinase gene family // Nature. 1986. V. 320. P. 415-421.

31.Beukeboom L.W. Bewildering Bs: an impression of the 1st B-chromosome conference // Heredity. 1994. V. 73. P. 328-336.

32.Bulet P., Hoflack B., Porchet M., Verbert A. Study of the conversion of GDP-mannose into GDP-fucose in Nereids: a biochemical marker of oocyte maturation // Eur J Biochem. – 1984. – V. 144. – P. 255-259.

33.Bhatnagar V.S. Microchromosomes in the somatic cells of Vulpes bengalensis Shaw // Chromosome Info Service. – 1973. – V. 15. – P. 32.

34.Blanks G.A., Shellhammer S.H. Chromosome polymorphism in California populations of harvest mice // J Mamm. – 1968. – V. 49. – P. 726–731.

35. Bueno D., Palacios-Giimenez O.M., Cabral-de-Mello D.C. Chromosomal mapping of repetitive DNAs in the grasshopper Abracris flavolineata reveal possible ancestry of the B chromosome and H3 histone spreading // Plos One. – 2013. – e66532.

36.Cabrero J., Viseras E., Camacho J.P.M. The B chromosomes of Locusta migratoria. Detection of negative correlation between mean chiasma frequency and the rate of accumulation of the Bs. A reanalysis of the available data about transmission of these B chromosomes // Genetica. – 1984. – V. 64. – P. 155-164.

37.Cabrero J., Bakkali M., Bugrov A., Warchalowska-Sliwa E., Lopez-Leon M.D., Perfectii F., Camacho J.P.M. Multiregional origin of B chromosomes in the grasshopper Eyprepocnemis plorans // Chromosoma. – 2003. – V. 112. – P. 207-211.

38.Camacho J.P.M., Cabrero J., Viseras E., Lopez-Leon M.D., Navas-Castillo J., Alche J.D. G-banding in two species of grasshopper and its relationship to C, N, and fluorescence banding techniques // Genome. – 1991. – V. 34. – P. 638-643.

39.Camacho J.P.M., Sharbel T.F., Beukeboom L.W. B-chromosome evolution // Philos Trans R Soc Lond B Biol Sci. 2000. V. 355. P. 163-178.

40.Camacho J. P. M. B chromosomes // The evolution of the genome: edited by Gregory T.R. – Amsterdam: Elsevier, 2005. – P. 224-273.

41.Chen X. C., Li X., Wang P., Liu Y., Zhang Z., Zhao G., Xu H., Zhu J., Qin X., Chen S., Hu L., Kong X. Novel association strategy with copy number variation for identifying new risk loci of human disease // Plos One. – 2010. – 5(8):e12185.

42.Civitelli M.V., Consentino P., Capanna E. Inter- and intra-individual chromosome variability in Thamnoys (Grammomys) gazellae (Rodentia, Miridae) B-chromosomes and structural heteromorphisms // Genetica.

1989. V. 79. P. 93-105.

43.Contrafatto G., Meester J.A., Willan K., Taylor P.J., Roberts M.A., Baker C.M. Genetic variation in the African rodent subfamily Otomyinae (Muriade). II. Chromosomal changes in some populations of Otomys irroratus // Cytogenet Cell Genet. – 1992. – V. 59. – P. 293–299.

44.Danilkin A. Behavioural Ecology of Siberian and European Roe Deer. – London: Chapman and Hall, 1996. – 296 pp.

45.De Villena P-M., Sapienza F. Female meiosis drives karyotypic evolution in mammals // Genetics. 2001. V. 159. P. 1179-1189.

46.Dedhar S. Cell-substrate interactions and signaling through ILK // Opin Cell Biol. – 2000. – V. 12. – P. 250-256.

47.Di Stefano G., Petronio C. Systematics and evolution of the Eurasian Plio Pleistocene tribe cervini (Artiodactyla, Mammalia) // Geol Romana. – 2002. – V. 36. – P. 311-334.

48.Donald T.M., Houben A., Leach C.R., Timmis J.N. Ribosomal RNA genes specific to the B chromosomes in Brachycome dichromosomatica are not transcribed in leaf tissue // Genome. – 1997. – V. 40. – P. 674-681.

49.Duke Becker S.E., Thomas R., Trifonov V.A., Wayne R.K., Graphodatsky A.S., Breen M.Anchoring the dog to its relatives reveals new evolutionary breakpoints across 11 species of the Canidae and provides new clues for the role of B chromosomes // Chromosome Res. – 2011. – V. 19. – P. 685 670.

50.Eichler E.E. Recent duplication, domain accretion and the dynamic mutation of the human genome // Trends Genet. 2001. V. 17. P. 661– 669. (Цитировано по Freeman et al., 2006).

51.Elsik C.G., Tellam R.L., Worley K.C. The genome sequence of taurine cattle: a window to ruminant biology and evolution // Science. – 2009. – V.

324. – P. 522-528.

52.Filipowicz W., Jaskiewicz L., Kolb F.A., Pillai R.S. Post-transcriptional gene silencing by siRNA and miRNAs // Curr Opin Struct Biol. – 2005. – V. 15. – P. 331-341.

53.Force A et al. Preservation of duplicate genes by complementary degenerative mutations // Genetics. 1999. V. 151. P. (Цитировано по Prince, Pickett, 2002).

54.Freeman J.L., Perry G.H., Feuk L., Redon R., McCarroll S.A., Altshuler D.M., Aburatani H., Jones K.W., Tyler-Smith C., Hurles M.E., Carter N.P., Stephen W., Scherer S.W., Lee C. Copy number variation: new insights in genome diversity // Gemone Res. 2006. V. 16. P. 949-961.

55.Freitas T.R.O., Mattevi M.S., Oliveira L.F.B., Souza M.J., Yonenaga Yassuda Y., Salzano F.M. Chromosome relationship in three representatives of the genus Holochilus (Rodentia, Cricetidae) from Brazil // Genetica. – 1983. – V. 61. – P. 13–20.

56.Gadi I.K., Sharma T., Raman R. Supernumerary chromosomes in Bandicota indica nemorivaga and a female individual with XX/X mosaicism // Genetica. – 1982. – V. 58. – P. 103–108.

57.Geist V. Deer of the world, their evolution, behavior and ecology. – Mechanicsburg, Pennsylvania, USA: Stackpole books, 1998. – 421pp.

58.Gotoh K. Uber die Chromosomenzaahl von Secale cereale L // Bot Mag Tokyo. – 1924. – V. 38. – P. 135-152.

59.Graphodatsky A.S., Kukekova A.V., Yudkin D.V., Trifonov V.A., Vorobieva N.V., Beklemisheva V.R., Perelman P.L., Graphodatskaya D.A., Trut L.N., Yang F., Ferguson-Smith M.A., Acland G.M., Aguirre G.D. The proto-oncogene C kit maps to canid B-chromosomes // Chromosome Res. 2005. V. 13. P. 113-122.

60.Green D.M. Muller’s ratchet and the evolution of supernumerary chromosomes // Genome. 1990. V. 33. P. 818-824.

61.Green D.M., Zeyl C.W., Sharbel T.F. The evolution of hypervariable sex and supernumerary B chromosomes in the relict New Zealand frog, Leiopelma hochstetteri // Evol Biol. 1993. V. 6. P. 417-441.

62.Gropp A., Marshall J., Flatz G., Olbrich M., Manyanondha K., Santadust A. Chromosomen polymorphismus durch uberzahlige Autosomen.

Beobachtungen an der Hausratte (R. rattus) // Z Saugetierk. – 1970. – V.

35. – P. 363. (Цитировано по Vujosevic, Blagoevic, 2004).

63.Gropp A., Marshall J., Markvong A. Chromosomal findings in the spiny mice of Thailand (genus Mus) and occurrence of a complex intraspecific variation in M. shortridgei // Z Saugetierk. – 1973. – V. 38. – P. 159–168.

(Цитировано по Vujosevic, Blagoevic, 2004).

64.Grubb P. Order Artiodactyla // Mammal species of the World. A taxonomic and geographic reference: edited by Wilson D.E., Reeder D.M. – Washington, USA: Smithsonian Institution Press, 1993. – P. 377-414.

65.de Guevara Ladron R.G., Diaz de la Guardia R. Frequency of chromosome polymorphism for pericentric inversions and B-chromosomes in Spanish populations of Rattus rattus frugivorus // Genetica. – 1981. – V. 57. – P.

99–103.

66.Gustavsson I., Sundt C.O. Karyotypes in five species of deer (Alces alces L., Capreolus capreolus L., Cervus elaphus L., Cervus nippon nippon Temm., and Dama dama L.) // Hereditas. 1968. V. 60. P.233–248.

67.Han Y., Liu X., Benny U., Corby Kistler H., VanEtten H.D. Genes determining pathogenicity to pea are clustered on a supernumerary chromosome in the fungal plant pathogen Nectria haematococca // The Plant Journal. 2001. V. 25(3). P. 305-314.

68.Han M.V., Demuth J.P., McGrath C.L., Casola C., Hahn M.W. Adaptive evolution of young gene duplicates in mammals // Genome Res. – 2009. – V. 19 (5). – P. 859-867.

69.Hannigan G.E., Leung-Hagesteijn C., Fitz-Gibbon L., Coppolino M.G., Radeva G., Filmus J., Bell J.C., Dedhar S. Regulation of cell adhesion and anchorage-dependent growth by a new beta 1-integrin-linked protein kinase // Nature. – 1996. – V. 379. – P. 91-96.

70.Hartl G.B., Reimoser F. Biochemical variation in roe deer (Capreolus capreolus L.): Are r-strategists among deer genetically less variable than K-strategists? // Heredity. 1988. V. 60. P. 221–227.

71.Hayata J. Chromosomal polymorphism caused by supernumerary chromosomes in field mouse, Apodemus giliacus // Chromosoma. – 1973. – V. 42. – P. 403–414.

72.Hayman D.L., Martin P.G. Supernumerary chromosomes in the marsupial Schoinobates volans (Ker) // Aust J Biol Sci. – 1965. – V. 18. – P. 1081– 1082.

73.Hayman D.L., Martin P.G., Waller P.F. Parallel mosaicism of supernumerary chromosomes and sex chromosomes in Echymipera kalabu // Chromosoma. 1969. V. 27. P. 371-380. (Цитировано по Vujosevic, Blagoevic, 2004).

74.Heinrich M.C., Blanke C.D., Druker B.J., Corless C.L. Inhibition of KIT tyrosine kinase activity: a novel molecular approach to the treatment of KIT-positive malignancies // J Clin Oncol. 2002. V. 20 (6). P. 1692 1703.

75.Hellsten U., Aspden J.L., Rio D.C., Rokhsar D.S. A segmental genomic duplication generates a functional intron // Nat Commun. – 2011. – 2:454.

76.Hewitt G.M. The integration of supernumerary chromosomes into the orthopteran genome // Cold Spring Harb Symp Quant Biol. 1973. V. 38.

P. 183-194.

77.Hsu T.C., Benirschke K. An Atlas of mammalian Chromosomes. – New York: Springer-Verlag, 1967-1971. – 264 pp.

78.Huang L., Chi J., Nie W., Wang J. Yang F. Phylogenomics of several deer species revealed by comparative chromosome painting with Chinese muntjac paints // Genetica. 2006. V. 127. P. 25-33.

79.Jamilena M., Ruiz-Rejon C., Ruiz-Rejon M. A molecular analysis of the origin of the Crepis capillaris B chromosome // Cell Sci. 1994. V. 107.

P. 703-708.

80.Jamilena M., Garrido-Ramos M., Ruiz-Rejon C., Ruiz-Rejon M., Parker J.

S. Characterisation of repeated sequences from microdissected B chromosomes of Crepis capillaries // Chromosoma. 1995. V. 104. P.

113-120.

81.Jones R.N., Rees H. B chromosomes. – New York: Academic Press, 1982.

– 266 pp.

82.Jones R.N. Are B chromosomes selfish? // The evolution of genome size:

edited by Cavalier-Smith T. – London: Wiley, 1985. – P. 397-425.

83.Jones R.N. B-chromosome drive // Am Nat. – 1991. – V. 137. – P. 430 442.

84.Jones L.R., Suzuki Y.J., Wang W., Kobayashi Y.M., Ramesh V., Franzini Armstrong C., Cleemann L., Morad M. Regulation of Ca2+ signaling in transgenic mouse cardiac myocytes overexpressing calsequestrin // J Clin Invest. – 1998. – V. 101. – P. 1385-1393.

85.Jones R.N., Gonzalez-Sanchez M., Gonzalez-Garcia M., Vega J.M., Puertas M.J. Chromosomes with a life of their own // Cytogenet Genome Res. – 2008. – V. 120. – P. 265-280.

86.Judd S.R., Cross S.P. Chromosomal variation in Microtus longicaudus (Merriam) // Murrelet. – 1980. – V. 61. – P. 2–5. (Цитировано по Vujosevic, Blagoevic, 2004).

87.Karamysheva T.V., Andreenkova O.V., Bochkaerev M.N., Borissov Y.M., Bogdanchikova N., Borodin P.M., Rubtsov N.B. B chromosomes of Korean field mouse Apodemus peninsulae (Rodentia, Murinae) analysed by microdissection and FISH // Cytogenet Genome Res. 2002. V. 96. P.

154–160.

88.Kasahara E. Variabilidade chromossomica em quarto especies de roedores das familias Cricetidae e Muridae: PhD thesis. – Univ. Sao Paulo, 1978.

(Цитировано по Vujosevic, Blagoevic, 2004) 89.Keyl H.G., Hagele K.B chromosomen bei Chironomus // Chromosoma.

1971. V. 35. P. 403-417.

90.Kolomiets O.L., Borbiev T.E., Safronova L.D., Borisov Y.M., Bogdanov Y.F. Synaptonemal complex analysis of B-chromosome behavior in meiotic prophase I in the East-Asiatic mouse Apodemus peninsulae (Muridae, Rodentia) // Cytogenet Cell Genet. – 1988. – V. 48(3). – P. 183 187.

91.Kulemzina A.I., Trifonov V.A., Perelman P.L., Rubtsova N.V., Volobuev V., Ferguson-Smith M.A., Stanyon R., Yang F., Graphodatsky A.S. Cross species chromosome painting in Cetartiodactyla: reconstructing the karyotype evolution in key phylogenetic lineages // Chromosome Res. – 2009. – V. 17. – P. 419-436.

92.Kuwada Y. On the number of chromosomes in maize // Bot Mag Tokyo. – 1925. – V. 39. – P. 227-234.

93.Lai Z-F., Chen Y-Z., Feng L-P., Meng X-M., Ding J-F., Wang L-Y., Ye J., Li P., Cheng X-S., Kitamoto Y., Monzen K., Komuro I., Sakaguchi N., Kim-Mitsuyama S. Overexpression of TNNI3K, a cardiac-specific MAP kinase, promotes P19CL6-deived cardiac myogenesis and prevents myocardial infarction-induced injury // Am J Heart Circ Physiol. – 2008. – V. 295. – P. H708-H716.

94. Lamatsch D.K., Trifonov V., Schories S., Epplen J.T., Schmid M., Schartl M. Isolation of a cancer-associated microchromosome in the sperm dependent parthenogen Poecilia formosa // Cytogenet Genome Res. – 2011. – V. 135. – P. 135-142.

95.Leach C.R., Houben A., Field B., Pistrick K., Demidov D., Timmis J.N.

Molecular evidence for transcription of genes on a B chromosome in Crepis capillaris // Genetics. – 2005. – V. 171. – P. 269-278.

96.Livingstone L.R., White A., Sprouse J., Livanos E., Jacks T., Tlsty T.D.

Altered cell cycle arrest and gene amplification potential accompany loss of wide-type p53 // Cell. – 1992. – V. 70. – P. 923-935. (Цитировано по Mondello et al, 2001).

97.Lobato L., Cantos G., Araujo B., Bianchi N.O., Merani S. Cytogenetics of the South American akodont rodents (Cricetidae) X. Akodon mollis: a species with XY females and B chromosomes // Genetica. – 1982. – V. 57.

– P. 199–205.

98.Longley A.E. Supernumerary chromosomes in Zea mays // J Agri Res. – 1927. – V. 35. – P. 769-784.

99.Lopez-Leon M.D., Neves N., Schwarzacher T., Heslop-Harrison T.S., Hewitt G.M., Camacho J.P.M. Possible origin of a B chromosome deduced from its DNA composition using double FISH technique // Chromosome Res. 1994. V. 2. P. 87-92.

100. Maia V., Yonenaga-Yassuda Y., Freitas T.R.O., Kasahara S., Sune Mattevi M., Oliviera L.F. Supernumerary chromosomes, Robertsonian rearrangement and variability of the sex chromosomes in scaly-footed water rat Nectomys squamipes (Cricetidae, Rodentia) // Genetica. – 1984. – V. 63. – P. 121–128. (Цитировано по Vujosevic, Blagoevic, 2004).

101. Makinen A., Fredga K. Banding analyses of the somatic chromosomes of raccoon dogs, Nyctereutes procyonides, from Finland // Fourth European Colloquium on the Cytogenetics of Domestic Animals. – 1980. (Цитировано по Vujosevic, Blagoevic, 2004).

102. Martis M.M., Klemme S., Banaei-Moghaddam A.M., Blattner F.R., Macas J., Schmutzer T., Scholz U., Gundlach H., Wicker T., imkov H., Novk P., Neumann P., Kubalkov M., Bauer E., Haseneyer G., Fuchs J., Doleel J., Stein N., Mayer KF., Houben A. Selfish supernumerary chromosome reveals its origin as a mosaic of host genome and organellar sequences // Proc Natl Acad Sci USA. – 2012. – V. 109. – P. 13343-13346.

103. McAllister B.F., Werren J.H. Hibrid origin of a B chromosome (PSR) in the parasitic wasp Nasonia vitripennis // Chromosoma. 1997.

V. 106. P. 243-253.

104. McLysaght A., Hokamp K., Wolfe K.H. Extensive genomic duplication during early chordate evolution // Nat Genet. 2002. V. 31.

P. 200204.

105. McQuade L.R., Hill R.J., Francis D. B-chromosome systems in the greater glider, Petauroides volans (Marsupialia: Pseudocheiridae). II Investigation of B chromosome DNA sequences isolated by micromanipulation and PCR // Cytogenet Cell Genet. 1994. V. 66. P.


155–161.

106. Mefford H.C., Eichler E.E. Duplication hotspots, rare genomic disorders and common disease // Curr Opin Genet Dev. – 2009. – V. 19 (3).

– P. 196-204.

107. Meylan A., Hausser J. Position citotaxonomique de quelques museragines du genere Crocidura au Tessisn (Mammalia: Insectivora).

Origine du dessin dentarie “Apodemus” (Rodentia, Mammalia) // CR Acad Sci Paris. – 1974. – V. 264. (Цитировано по Vujosevic, Blagoevic, 2004).

108. Mondello C., Faravelli M., Pipitone L., Rollier A., Di Leonardo A., Giulotto E. Gene amplification in fibroblasts from ataxia telangiectasia (AT) patients and in X-ray hypersensitive AT-like Chinese hamster mutants // Carcinogenesis. – 2001. – V. 22. – P. 141-145.

Moore J.W., Elder R.L. Chromosome of the fox // J Hered. 1965.

109.

V. 56. P. 142–143.

110. Moritz C., Dowling T.E., Brown W.M. Evolution of animal mitochondrial DNA: relevance for population biology and systematics // Ann Rev Ecol. – 1987. – V. 18. – P. 269-292.

111. Myers P., Carleton M.D. The species Oryzomys (Oligoryzomys) in Paraguay and the identity of Azara’s “Rat sixime ou Rat Tarse Noir” // Publ Mus Univ Mich. – 1981. – V. 161. – P. 1–141. (Цитировано по Vujosevic, Blagoevic, 2004).

112. Nachman M.W. Geographic patterns of chromosomal variation in South American marsh rats, Holochilus brasiliensis and H. vulpinus // Cytogenet Cell Genet. 1992. V. 61. P. 10-17. (Цитировано по Vujosevic, Blagoevic, 2004).

113. Neitzel H. Chromosome evolution of Cervidae: karyotypic and molecular aspects // Cytogenetics: edited by Obe G., Basler A. – Berlin, Heidelberg: Springer, 1987. –P. 90–112.

114. Nes et al. Kromosomstudier hos rein (Rangifer tarandus) // Nord Vet Med. 1965. V. 17. P. 589-593. по (Цитировано www.bionet.nsc.ru/chromosomes).

115. Nur U. Mitotic instability leading to an accumulation of B chromosomes in grasshoppers // Chromosoma. – 1969. – V. 27. – P. 1-19.

116. Nur U., Werren J.H., Eickbush D.G., Burke W.D., Eickbush T.H. A selfish B chromosome that enhances ist transmission by eliminating the paternal genome // Science. – 1988. – V. 240. – P. 512-514.

117. Obara Y., Tomyiasu T., Saitoh K. Chromosome studies in the Japanese vespertilionid bats. I. Karyotypic variation in Myotis macrodactylus Temmink // Jpn J Genet. 1976. V. 51. P.201– (Цитировано по Vujosevic, Blagoevic, 2004).

118. Obara Y., Sasaki S. Fluorescent approaches on the origin of B chromosomes of Apodemus argenteus hokkaidi // Chrom Sci. – 1997. – V.

1. – P. 1–5.

119. Ohno S., Wolf U., Atkin N. B. Evolution from fish to mammals by gene duplication // Hereditas. – 1968. – V. 59. – P. 169-187.

120. Otto E., McCord S., Tlsty T.D. Insreased incidence of CAD gene amplification in tumorigenic rat lines as an indicator of genomic instability of neoplastic cells // J Biol Chem. – 1989. – V. 264. – P. 3390-3396.

(Цитировано по Mondello et al, 2001).

121. Palestis B.G., Burt A., Jones R.N., Trivers R. B chromosomes are more frequent in mammals with acrocentric karyotypes: support for the theory of centromeric drive // Proc R Soc Lond B (Suppl.). 2004. V.

271. P. s22-s24.

122. Pastuszak I., Ketchum C., Hermanson G., Sjoberg E.J., Drake R., Elbein A.D. GDP-L-fucose pyrophosphorylase. Purification, cDNA cloning and properties of the enzyme // J Biol Chem. – 1998. – V. 273. – P.

30165-30174.

123. Patton J.L. A complex system of chromosomal variation in the pocket mouse, Perognathus baileyi Merriam // Chromosoma. 1972. V.

36. P. 241-255.

124. Patton J.L. B-chromosome system in the pocket mouse, Perognathus baileyi: Meiosis and C-band studies // Chromosoma. 1977. V. 60. P.

1-14.

125. Patton J.L., Sherwood S.W. Genome evolution in pocket gophers (Genus Thomomys). Heterochromatin variation and speciation potential // Chromosoma. – 1982. – V. 85. – P. 149-162.

126. Peppers J.A., Wiggins L.E., Baker R.J. Nature of B chromosomes in the harvest mouse Reithrodontomys megalotis by fluorescence in situ hybridization (FISH) // Chromosome Res. 1997. V. 5. P. 475-479.

Piekowska-Schelling A., Schelling C., Zawada M., Yang F., Bugno 127.

M., Ferguson-Smith M. Cytogenetic studies and karyotype nomenclature of three wild canid species: maned wolf (Chrysocyon brachyurus), bat-eared fox (Otocyon megalotis) and fennec fox (Fennecus zerda) // Cytogenet Genome Res. 2008. V. 121. P. 25–34.

128. Pink R.C., Wicks K., Caley D.P., Punch E.K., Jacobs L., Carter D.R.

Pseudogenes: pseudo-functional or key regulators in health and disease? // RNA. – 2011. – V. 17. – P. 792-798.

129. Pitra C., Fickel J., Meijaard E., Groves P.C. Evolution and phylogeny of old world deer // Mol Phylogenet Evol. – 2004. – V. 33. – P.

880-895.

130. Poletto A.B., Ferreira I.A., Martins C. The B chromosomes of the African cichlid fish Haplochromis obliquidens harbour 18S rRNA gene copies // BMC Genet. – 2010. – 11-1.

131. Prince V.E., Pickett F.B. Splitting pairs: the diverging fates of duplicated genes // Nat Rev Genet. 2002. V. 3. P. 827-837.

132. Rao K.S., Aswathanrayana N.V., Prakash K.S. Supernumerary (B) chromosomes in Indian bush rat Golunda ellioti (Gray) // MCN. – 1979. – V. 20. – P. 79. (Цитировано по Vujosevic, Blagoevic, 2004).

133. Raman R., Sharma T. DNA replication, G- and C- bands and meiotic behaviour of supernumerary chromosomes of Rattus rattus // Chromosoma.

1974. V. 45. P. 111-119. (Цитировано по Vujosevic, Blagoevic, 2004).

134. Randi E., Pierpaoli M., Danikin A. Mitochondrial DNA polymorphism in populations of Siberian and European roe deer (Capreolus pygargus and C. capreolus) // Heredity. 1998a. V. 80. P.

429–437.

135. Randi E., Mucci N., Pierpaoli M., Douzery E. New phylogenetic perspectives on the Cervidae (Artiodactyla) are provided by the mitochondrial cytochrome b gene // Proc R Soc Lond. 1998b. V. 265.

P. 793-801.

136. Randolph L.F. Types of supernumerary chromosomes in maize // Anat Rec. – 1928. – V. 41. – P. 102.

137. Reddy P., Peterkofsky A., McKenney K. Translational efficiency of the Escherichia coli adenylate cyclase gene: Mutating the UUG initiation codon to GUG or AUG results in increased gene expression // Proc Natl Acad Sci USA. – 1985. – V. 82. – P. 5656-5660.

138. Redon R., Ishikawa S., Fitch K.R., Feuk L., Perry G.H., Andrews T.D., Fiegler H., Shapero M.H., Carson A.R., Chen W., Cho E.K., Dallaire S., Freeman J.L., Gonzalez J.R., Grataco`s M., Huang J., Kalaitzopoulos D., Komura D., MacDonald J.R., Marshall C.R., Mei R., Montgomery L., Nishimura K., Okamura K., Shen F., Somerville M.J., Tchinda J., Valsesia A., Woodwark C., Yang F., Zhang J., Zerjal T., Zhang J., Armengo L., Conrad D.F., Estivill X., Tyler-Smith C., Carter N.P., Aburatani H., Lee C., Jones K.W., Scherer S.W., Hurles M.E. Global variation in copy number in the human genome // Nature. 2006. V. 444. P. 444454.

Rvay T., Villagmez D.A.F., Brewer D., Chenier T., King W.A.

139.

GTG mutation in the start codon of the androgen receptor gene in a family of horses with 64,XY disorder of sex development // Sex Dev. – 2012. – V.

6. – P. 108-116.

Robins L.W. “Southwest. Natur.” – 1981. – V. 26. – P. 201- 140.

(Цитировано по http://www.bionet.nsc.ru/chromosomes) 141. Rubtsov B.N., Karamysheva V.T., Andreenkova V.O., Bochkaerev N.M., Kartavtseva V.I., Roslik V.G., Borissov M.Y. Comparative analysis of micro and macro B chromosomes in the Korean field mouse Apodemus peninsulae (Rodentia, Mirinae) performed by chromosome microdissection and FISH // Cytogenet Genome Res. 2004. V. 106. P. 289-294.

142. Ruiz-Estevez M., Lopez-Leon M.D., Cabrero J., Camacho J.P. B chromosome ribosomal DNA is functional in the grasshopper Eyprepocnemis plorans // Plos One. – 2012. – e36600.

143. Sapre A.B., Deshpande D.S. Origin of B chromosomes in Coix L.

through spontaneous interspecific hybridization // J Hered. 1987. V. 78.

P. 191-196.

144. Sbalqueiro I.J., Mattevi M.S., Oliveira L.F.B., Solano M.J.V. B chromosome system in populations of Oryzomys flavescens (Rodentia, Cricetidae) from southern Brazil // Acta Ther. – 1991. – V. 36. – P. 193– 199.

145. Schartl M., Nanda I., Schlupp I., Wilde B., Epplen J.T., Schmidt M., Parzefall J. Incorporation of subgenomic ammounts of DNA as compensation for mutational load in a gynogenetic fish // Nature. 1995.

V. 373. P. 68-71.

Shaikh T.H., Kurahashi H., Saitta S.C., O’Hare A.M., Hu P., Roe 146.

B.A., Driscoll D.A., McDonald-McGinn D.M., Zackai E.H., Budarf M.L et al. Chromosome 22-specific low copy repeats and the 22q11.2 deletion syndrome: genomic organization and deletion endpoint analysis // Hum Mol Genet. 2000. V. 9. P. 489–501.

147. Sharbel T.F., Green D.M., Houben A.B chromosome origin in the endemic New Zealand frog Leiopelma hochstetteri through sex chromosome devolution // Genome. 1998. V. 41. P. 14-22.

148. Sharp A.J., Locke D.P., McGrath S.D., Cheng Z., Bailey J.A., Vallente R.U., Pertz L.M., Clark R.A., Schwarrtz S., Seqraves R., Oseroff V.V., Albertson D.G., Pinkel D., Eichler E.E. Segmental duplications and copy-number variation in the human genome // Am J Hum Genet. – 2005.


– V. 77(1). – P. 78-88.

149. Sharp A.J., Hansen S., Selzer R.R., Cheng Z., Regan R., Hurst J.A., Stewart H., Price S.M., Blair E., Hennekam R.C., Fitzpatrick C.A., Segraves R., Richmond T.A., Guiver C., Albertson D.G., Pinkel D., Eis P.S., Schwartz S., Knight S.J.L., Eichler E.E. Discovery of previously unidentified genomic disorders from the duplication architecture of the human genome // Nat Genet. – 2006. – V. 38. – P. 1038-1042.

150. Shelhammer H.S. Supernumerary chromosomes of the harvest mouse, Reihrodontomys megalotis // Chromosoma. – 1969. – V. 27. – P.

102-108.

151. Shi L., Tang L., Ma K., Ma C. Synaptonemal complex formation among supernumerary B chromosomes: an electron microscopic study on spermatocytes of Chinese raccon dogs // Chromosoma. – 1988a. – V. 97. – P. 178-183.

152. Shi L., Ma C. A new karyotype of muntjac (Muntiacus sp.) from Gongshan county in China // Zool Res. – 1988b. V. 9. P. 343-350.

153. Silva M.J.J., Yonenaga-Yassuda Y. B chromosomes in Brazilian rodents // Cytogenet Genome Res. 2004. V. 106. P. 257-263.

154. Sokolov V.E., Prikhodko V.I. Taxonomy of the musk deer (Artiodactyla, Mammalia) // Izv Akad Nauk Ser Biol. 1998. V. Jan Feb. P. 37.

155. Soldatovic B., Savic. I., Seth P., Reichstein H., Tolksdorf M.

Comparative karyological study of the genus Apodemus // Acta Vet. – 1975. – V. 25. – P. 1–10. (Цитировано по Vujosevic, Blagoevic, 2004).

156. Song K., Lu P., Tang K., Osborn T. C. Rapid genome change in synthetic polyploids of Brassica and its implications for polyploidy evolution // Proc Natl Acad Sci USA. 1995. V. 92. P. 77197723.

157. Stitou S., Diaz de la Guardia R., Jimenez R., Burgos M. Inactive ribosomal cistrons are spread throughout the B chromosomes of Rattus rattus (Rodentia, Muridae). Implications for their origin and evolution // Chromosome Res. 2000. V. 8. P. 305-311.

158. Suyama M., Harrington E., Bork P., Torrents D. Identification and analysis of genes and pseudogenes within duplicated regions in the human and mouse genomes // Plos Comput Biol. – 2006. – V. 2. – P. e76.

159. Swim M.M., Kaeding K.E., Ferree P.M. Impact of a selfish B chromosome on chromatin dynamics and nuclear organization in Nasonia // J Cell Sci. – 2012. – V. 125. – P. 5241-5249.

160. Switonski M., Gustavsson I., Hojer K., Ploen L. Synaptonemal complex analyses of the B-chromosomes in spermatocytes of the silver fox (Vulpes fulvus Desm.) // Cytogenet Cell Genet. – 1987. – V. 45. – P. 84-92.

161. Szczerbal I., Switonski M. B chromosomes of the Chinese raccoon dog (Nyctereutes procyonoides procyonoides Gray) contain inactive NOR like sequences // Caryologia. 2003. V. 56. P. 213-216.

162. Taru H., Hasegawa Y. The Plio-Pleistocene fossil mammals from the Kasumi and Tama hills // Mem Nat Sci Mus. – 2002. – V. 38. – P. 43-56.

Taylor K.M. et al. In: Comparative Mammalian Cytogenetics. – 163.

1969. (Цитировано по www.bionet.nsc.ru/chromosomes).

164. Teruel M., Cabrero J., Perfectti F., Camacho J.P.M. B chromosome ancestry revealed by histone genes in the migratory locust // Chromosoma.

– 2010. – V. 119. – P. 217-225.

165. Thomas J.H. Genomic imprinting proposed as a surveillance mechanism for chromosome loss // Proc Natl Acad Sci USA. 1995. V.

92. P. 480-482.

166. Trifonov V.A., Perelman P.L., Kawada S-I., Iwasa M.A., Oda S-I., Graphodatsky A.S. Complex structure B-chromosomes in two mammalian species: Apodemys peninsulae (Rodentia) and Nyctereutes procyonides (Carnivora) // Chromosome Res. 2002. V. 10. P. 109-116.

167. Vandenbark G.R., de Castro C.M., Taylor H., Dew-Knight S., Kaufman R.E. Cloning and structural analysis of the human C kit gene // Oncogene. 1992. V. 7(7). P. 1259-1266.

168. Vassart M., Guedant A., Vie J.C., Keravec J., Seguela A., Volobouev V.T. Chromosomes of Alouatta seniculus (Platyrrhini, Primates) from French Guiana // J Heredity. 1996. V. 87. P. 331–334. (Цитировано по Vujosevic M, Blagoevic J, 2004).

169. Volleth M. Comparative analysis of the banded karyotypes of the European Nyctalus species (Vespertilionidae, Chiroptera) // Prague Studies in Mammology: edited by Horacek I, Vohralik V. – Prague: Charles University Press, 1992. – P. 221–226. (Цитировано по Vujosevic, Blagoevic, 2004).

170. Volobujev V.T., Radzabli S.I., Belajeva E.S. Investigation of the nature and the role of additional chromosomes in silver foxes. III.

Replication pattern in additional chromosomes // Genetika. 1976. V.

12. P. 30-34.

171. Volobujev V.T., Sicard B., Aniskin V.M., Gautun J.J., Granjon L.

Robertsonian polymorphism, B chromosomes variation and sex chromosomes heteromorphism in the African water rat Dasymys (Rodentia, Muridae) // Chromosome Res. – 2000. – V. 8. – P. 689–697.

172. Vujosevic M., Zivkovic S. Numerical chromosome polymorphism in Apodemus flavicollis and A. sylvaticus (Mammalia: Rodentia) caused by supernumerary chromosomes // Acta Vet. – 1987. – V. 37. – P. 81–92.

173. Vujosevic M., Radosavljevic J., Zivkovic S. Meiotic behavior of B chromosomes in yellow necked mouse Apodemus flavicollis // Arh Biol.

Nauka. – 1989. – V. 41. – P. 39-42.

174. Vujosevic M., Blagoevic J. B chromosomes in populations of mammals // Cytogenet Genome Res. 2004. V. 106. P. 247 – 256.

175. Wang J., Zhao X., Deng Y., Qi H., Liu Y., Zhang Z., Koh H., Shan X. Karyotypes and B chromosome of greater long-tailed hamster (Cricetulus triton) // Acta Ther Sinica. – 1999. – V. 19. – P. 197–211.

176. Ward O.G. Chromosomes studies in Japanese raccoon dogs: X chromosomes, supernumeraries, and heteromorphism // Mammal Chrom Newsl. 1984. V. 25. P. 34. (Цитировано по Vujosevic, Blagoevic, 2004).

177. Ward O.G., Wurster-Hill D.H., Ratty F.J., Song Y. Comparative cytogenetics of Chinese and Japanese raccoon dogs, Nyctereutes procyonoides // Cytogenet Cell Genet. – 1987. – V. 45. – P. 177-186.

178. Wahrman J., Gourevitz P. The chromosome biology of the 2n= black rat, Rattus rattus // Chromosomes Today: edited by Wahrman J, Lewis K.R. – Berlin: Springer-Verlag, 1973. – P. 433-434.

179. Wheeler F.C., Tang H., Marks O.A., Hadnott T.N., Chu P-L., Mao L., Rockman H.A., Marchuk D.A. TNNI3K modifies disease progression in murine models of cardiomyopathy // Plos Genet. – 2009. – V. 5. – P.

e1000647.

180. Wilson E.B. The supernumerary chromosomes of Hemiptera // Science. 1907. V. 26. P. 870-871.

181. Wilson D.E., Reeder D.M. Mammal species of the world: a taxonomic and geographic reference. Washington, USA: Smithsonian Institution Press, 1993. – 1206 pp.

182. Wilson D.E., Reeder D.M. Mammals species of the world a taxonomic and geographic reference. – Baltimore, Maryland, USA: The Jonhs Hopkins University Press, 2005. – 1945pp.

183. Wiltshire S.A., Leiva-Torres G.A., Vidal S.M. Quantitative trait locus analysis, pathway analysis, and consomic mapping show genetic variants of TNNI3K, FPGT, or H28 control susceptibility to viral myocarditis // J Immunol. – 2011. – V. 186. – P. 6398-6405.

184. Windle B., Draper B.W., Yin Y.X., OGorman S., Wahl G.M. A central role for chromosome breakage in gene amplification, deletion formation, and amplicon integration // Genes Dev. – 1991. – V. 5. – P. 160 174.

185. Wright J.A., Smith H.S., Watt F.M., Hancock M.C., Hundson D.L., Stark G.R. DNA amplification is rare in normal human cells // Proc Natl Acad Sci USA. – 1990. – V. 87. – P. 1791-1795. (Цитировано по Mondello et al, 2001).

186. Wurster D.H., Benirschke K. Chromosome studies in some deer, the springbok, and the pronghorn, with notes on placentatian in deer // Mammal Chrom Newsl. 1967. V. 8. P. 226-229.

187. Wurster D.H., Benirschke K. Indian muntjac, Muntiacus muntjak: a deer with a low diploid chromosomes number // Science. 1970. V. 168.

P. 1364-1366.

Wurster – Hill D.H., Seidel B. The G-banded chromosomes of 188.

Roosevelt’s muntjac, Muntiacus rooseveltorum // Cytogenet Cell Genet.

1985. V. 39. P. 75-76.

189. Wurster-Hill D.H., Ward O.G., Kada B.H., Whittmore S. Banded chromosome studies and B chromosomes in wild-caught raccoon dogs, Nyctereutes procyonides viverinus // Cytogenet. Cell Genet. 1986. V.

42. P. 85-93.

190. Wurster-Hill D.H., Ward O.G., Davis B.H., Park J.P., Moyzis R.K., Meyne J. Fragile sites, telomeric DNA sequences, B chromosomes, and DNA content in raccoon dogs, Nyctereutes procyonoides, with comparative notes on foxes, coyote, wolf and raccoon // Cytogenet. Cell Genet. 1988.

V. 49. P. 278-281.

191. Xiao C-T., Zhang M-H., Fu Y., Koh H-S. Mitochondrial DNA distinction of northeastern China roe deer, Siberian roe deer, and European roe deer, to clarify the taxonomic status of northeastern China roe deer // Biochem Genet. 2007. V. 45. P. 93-102.

192. Xing J., Wang H., Belancio V.P., Cordaux R., Deininger P.L., Batzer M.A. Emergence of primate genes by retrotransposon mediated sequence transduction // PNAS. 2006. V. 103. P. 17608-17613.

193. van Wynsberghe N.R., Engstrom M.D. Chromosomal variation in collared lemmings (Dicrostonyx) from the western Hudson Bay region // Musk-Ox. – 1992. – V. 39. – P. 203–209.

194. Vorobieva N.V., Sherbakov D.Y., Druzhkova A.S., Stanyon R., Tsybankov A.A., Vasilev S.K., Shunkov M.V., Trifonov V.A., Graphodatsky A.S. Genotyping of Capreolus pygargus fossil DNA from Denisova Cave reveals phylogenetic relationships between ancient and modern populations // Plos One. – 2011. – e24045.

195. Yang F., Carter N.P., Shi L., Ferguson-Smith M.A. A comparative study of karyotypes of muntjacs by chromosome painting // Chromosoma.

1995. V. 103. P. 642–652.

Yang F., O’Brien P.C., Wienberg J., Ferguson-Smith M.A. Evolution 196.

of the black muntjac (Muntiacus crinifrons) karyotype revealed by comparative chromosome painting // Cytogenet Cell Genet. 1997a. V.

76. P. 159–163.

Yang F., O’Brien P.C.M., Wienberg J., Ferguson-Smith M.A. A 197.

reappraisal of the tandem fusion theory of karyotype evolution in the Indian muntjac using chromosome painting // Chromosome Res. 1997b.

V. 5. P. 109–117.

198. Yang F., O’Brien P.C.M., Wienberg J., Neitzel H., Lin C.C., Ferguson-Smith M.A. Chromosomal evolution of the Chinese muntjac (Muntiacus reevesi) // Chromosoma. 1997c. V. 106. P. 37-43.

199. Yang F., O`Brien P., Milne B., Graphodatsky A., Solansky N., Trifonov V., Rens W., Sargan D., Ferguson-Smith M. A complete comparative chromosome map for the dog, red fox, and and human and its integration with canine genetic maps // Genomics. – 1999. – V. 62. – P.

189-202.

200. Yang S.W., Hitz M.P., Andelfinger G. Ventricular septal defect and restrictive cardiomyopathy in a paediatric TNNI3K mutation carrier // Cardiol Young. – 2010. – V. 20(5). – P. 574-576.

Yonenaga-Yassuda Y., de Souza M.J., Kasahara S., L’Abbate M., 201.

Chu H.T. Supernumerary system in Proechimys iheringi iheringi (Rodentia, Echimydae), from the state of Sao Paulo, Brazil // Caryologia. – 1985. – V. 38. – P. 179–194.

202. Yonenaga-Yassuda Y., do Prado C.R., Mello D.A. Supernumerary chromosomes in Holochilus brasiliensis and comparative cytogenetic analysis with Nectomys squamipes (Cricetidae, Rodentia) // Rev Brasil Genet. – 1987. – V. 10. – P. 209–220.

203. Yonenaga-Yassuda Y., Maia V., L’Abbate M. Two tandem fusions and supernumerary chromosomes in Nectomys squamipes (Cricetidae, Rodentia) // Caryologia. – 1988. – V. 41. – P. 25-39.

204. Yonenaga-Yassuda Y., Assis M.F.L., Kasahara S. Variability of the nucleolus organizer regions and the presence of the rDNA genes in the supernumerary chromosome of Akodon aff. arviculoides (Cricetidae, Rodentia) // Caryologia. 1992. V. 45. P. 163-174.

205. Yong H.S., Dhaliwal S.S. Supernumerary (B-) chromosomes in the Malayan house rat, Rattus rattus diardii (Rodentia, Muridae) // Chromosoma. – 1972. – V. 36. – P. 256–262.

206. Yosida T.H. Population survey of B-chromosomes in black rat // Ann Rep Nat Inst Genet. – 1976. – V. 26. – P. 33.

207. Yoshida K., Terai Y., Mizoiri S., Aibara M., Nishihara H., Watanabe M., Kuroiwa A., Hirai H., Hirai Y., Matsuda Y., Okada N. B chromosomes have a functional effect on female sex determination in lake Victoria cichlid fishes // Plos Genet. – 2011. – e1002203.

208. Yu W., Han F., Gao Z., Vega J.M., Birchler J.A. Construction and behaviour of engineered minichromosomes in maize // Proc Natl Acad Sci USA. – 2007. – V. 104. – P. 8924-8929.

209. Yudkin D.V., Trifonov V.A., Kukekova A.V., Vorobieva N.V., Rubtsova N.V., Yang F., Acland G.M., Ferguson-Smith M.A., Graphodatsky A.S. Mapping of KIT adjacent sequences on canid autosomes and B chromosomes // Genome Res. 2007. V. 116. P.

100-103.

210. Yunis E.J., Torres de Caballero O. M., Ramirez C., Ramirez Z. E.

Chromosomal variations in the primate Alouatta seniculus seniculus // Folia Primatol. 1976. V. 25. P. 215–224. (Цитировано по Vujosevic, Blagoevic, 2004).

211. Zhao Y., Meng X.M., Wei Y.J., Zhao X.W., Liu D.Q., Cao H.Q., Liew C.C., Ding J.F. Cloning and characterization of a novel cardic specific kinase that interacts specifically with cardiac troponin I // J Mol Med. – 2003. – V. 81. – P. 297-304.

212. Zhou X., Lin Z., Ma H. Phylogenetic detection of numerous gene duplications shared by animals, fungi and plants // Genome Biol. – 2010.

11:R38.

213. Zhou Q., Zhu H.M., Huang Q.F., Zhao L., Zhang G.J., Roy S.W., Vicoso B., Xuan Z.L., Ruan J., Zhang Y., Zhao R.P., Ye C., Zhang X.Q., Wang J., Wang W., Bachtrog D. Deciphering neo-sex and B chromosome evolution by the draft genome of Drosophila albomicans // BMC Genomics. – 2012. – 13: 109.

214. Ziegler C.G., Lamatsch D.K., Steinlein C., Engel W., Schartl M., Schmid M. The giant B chromosome of the cyprinid fish Alburnus alburnus harbours a retrotransposon-derived repetitive DNA sequence // Chromosome Res. – 2003. – V.11. – P. 23-35.

215. Zima J., Macholan M. B chromosomes in the wood mice (genus Apodemus) // Acta Ther. – 1995. – P. 75–86.

216. Zimmerman E.G. Karyology, systematics and chromosomal evolution in the rodent genus Sigmodon // Michigan State Univ Publ Mus Biol Ser – 1970. – V. 4. – P. 385–394.

Приложение 1. Нуклеотидные последовательности первого экзона, гена FPGT у представителей семейства оленьих ДОР-библиотека В-хромосом GTGGACGCTGAAAGTAGACCTGCCGGCGAATCTTTGCGAGAAGCCACCCAGCGAA GGTTGCGGAGGTTTTCAGAGCTTAGAGGGTACGTAC Сибирская косуля без В-хромосом (Capreolus pygargus) ATGGACGCTGAAAGTAGACCTGCCGGCGAATCTTTGCGAGAAGCCACCCAGCGAA GGTTGCGGAGGTTTTCAGAGCTTAGAGGTAC Сибирская косуля с 4 В-хромосомами (Capreolus pygargus) GTGGACGCTGAAAGTAGACCTGCCGGCGAATCTTTGCGAGAAGCCACCCAGCGAA GGTTGCGGAGGTTTTCAGAGCTTAGAGGGTACGTAC Сибирская косуля с 4 В-хромосомами (Capreolus pygargus)_клон GTGGACGCTGAAAATAGACCTGCCGGCGAATCTTTGCGAGAAGCCACCCAGCGAA GGTTGCGGAGGTTTTCAGAGCTTAGAGGGTACGTAC Сибирская косуля с 8 В-хромосомами (Capreolus pygargus) GTGGACGCTGAAAGTAGACCTGCCGGCGAATCTTTGCGAGAAGCCACCCAGCGAA GGTTGCGGAGGTTTTCAGAGCTTAGAGGGTACGTAC Европейская косуля (Capreolus capreolus) (CCA) R*TGGACGCTGAR*AGTAGACCTTCCGGCGAATCTTTGCGAGAAGCCACCCAGCGA AGGTTGCGGAGGTTTTCAGAGCTTAGAGGTAC Европейская косуля (Capreolus capreolus) (Eu103) R*TGGACGCTGAR*AGTAGACCTTCCGGCGAATCTTTGCGAGAAGCCACCCAGCGA AGGTTGCGGAGGTTTTCAGAGCTTAGAGGTAC Европейская косуля (Capreolus capreolus)_клон Eu ATGGACGCTGAGAGTAGACCTGCCGGCGAATCTTTGCGAGAAGCCACCCAGCGAA GGTTGCGGAGGTTTTCAGAGCTTAGAGGTAC Марал алтайский (Cervus elaphus sibiricus) ATGGAAGCTGAAAGTAGACTTGCCGGCGAATCTTTGCGAGAAGCCACCCAGCGAA GGTTGCGGAGGTTTTCAGAGCTTAGAGGTAC Серый мазама (Mazama gouazoubira) ATGGAGGCTGAAAGTAGACCTGCCGGCGAATCTTTGCAAGAAGCCACCCAGCGAA GGTTGCGGAGGTTTTCAGAGCTTAGAGGTAC Примечание: * - смешанные пики, соответствующие аденину и гуанину Приложение 2. Нуклеотидные последовательности второго экзона гена FPGT у представителей семейства оленьих ДОР-библиотека В-хромосом AAAAAAAAGGAGTTACCCCTTGGAGTTCAATATCATGTTTTTGCTGATCCTTCTGG AGCCAGAATTGGTATGCGTTTATGGTTAGATTT Сибирская косуля без В-хромосом (Capreolus pygargus) GGCAAATCAGTGGCACCTGGAGAATTCTGGGACATTGTTGTAATAACAGCAGCTG ATGAAAAACAGAAACTTGCTTATAAGCAACAGCTTTCAGAAAAGCTG AAAAAAAAGGAGTTACCCCTTGGAGTTCAATATCATGTTTTTGCTGATCCTTCTGG AGCCAAAATTGG Сибирская косуля с 8 В-хромосомами (Capreolus pygargus) AAAAAAAAGGAGTTACCCCTTGGAGTTCAATATCATGTTTTTGCTGATCCTTCTGG AGCCAGAATTGGTATGCGTTTATGGTTAGATTT Марал алтайский (Cervus elaphus sibiricus) GGCAAATCAGTGGCAGCTGGAGAATTCTGGGACATTGTTGTATTAACAGCAGCTAA TGAAAAACAGAAACTTGCTTATAAGCAACAGCTTTCAGAAAAGCTGAAAAAAAAG GAGTTACCCCTTGGAGTTCAATATCATGTTTTTGCTGATCCTCCTGGAGCCAAAATT GG Лось (Alces alces) GGCAAATCAATGGCAGCTGGAGAATTCTGGGACATTGTTGTAATAACAGCAGCTG ATGAAAAACAGGAACTTGCTTATAAGCAACAGCTTTCAGAAAAGCTTAAAAAAAA GGAGTTACCCCTTGGAGTTCAATATCATGTTTTTGCTGATCCTTCTGGAGCCAAAAT TGG Серый мазама (Mazama gouazoubira) GGCAAATCAATGGCAGCTGGAGAATTCTGGGACATTGTTGTAATAACAGCAGCTA ATGAAAAACAGGAACTTGCTTATAAGCAACAGCTTTCAGAAAAGCTGAAAAAAAA GGAGTTACCCCTTGGAGTTAAATATCATGTTTTTGCTGATCCTCCTGGAGCCAAAAT TGG Приложение 3. Нуклеотидные последовательности третьего экзона гена FPGT у представителей семейства оленьих ДОР-библиотека В-хромосом GGAAATGGAGGAGCAACCCTTTGTGCCCTTCGATGTTTGGAAAAGCTTTATGGAGA TGAATGGAATTCTTTTACСATCCTATTAATTCATTCT Сибирская косуля без В-хромосом (Capreolus pygargus) GGAAATGGAGGAGCAACCCTTTGTGCCCTTCGATGTTTGGAAAAGCTTTATGGAGA TGAATGGAATTCTTTTACCATCCTATTAATTCATTCT Сибирская косуля c 8 В-хромосомами (Capreolus pygargus) GGAAATGGAGGAGCAACCCTTTGTGCCCTTCGATGTTTGGAAAAGCTTTATGGAGA TGAATGGAATTCTTTTACCATCCTATTAATTCATTCT Европейская косуля (Capreolus capreolus) (Eu103) GGAAATGGAGGAGCAACCCTTTGTGCCCTTCGATGTTTGGAAAAGCTTTATGGAGA TGAATGGAATTCTTTTACCATCCTATTAATTCATTCT Марал алтайский (Cervus elaphus sibiricus) GGAAATGGAGGAGCAACCCTTTGTGCCCTTCGATGTTTGGAAAAGCTTTATGGAGA TGAATGGAATTCTTTTACCATCCTATTAATTCACTCT Лось (Alces alces) GGAAATGGAGGAGCAACCCTTTGTGCCCTTCGATGTTTGGAAAAGCTTTATGGAGA TGAATGGAATTCTTTTACCATCCTATTAATTCACTCT Серый мазама (Mazama gouazoubira) GGAAATGGAGGAGCAACTCTTTGTGCCCTTCGATGTTTGGAAAAGCTTTATGGAGA TGAAtGGaATTCTTTTACCATCCTATTAATTCACTCT Приложение 4. Нуклеотидные последовательности первого экзона гена TNNI3K у представителей семейства оленьих Сибирская косуля c 8 В-хромосомами (Capreolus pygargus) GATGAATGGAAGAAGAAAGTCAGTGAATCTTATGTTATTGTAATAGAAAGATTAG AAGATGACCTGCAGATCAAAGAAAAAGAACTTACAGAACTGAGGCATATATTTGG G Европейская косуля (Capreolus capreolus) (CCA) GATGAATGGAAGAAGAAAGTCAGTGAATCTTATGTTATTGTAATAGAAAGATTAG AAGATGACCTGCAGATCAAAGAAAAAGAACTTACAGAACTGAGGCATATATTTGG G Марал алтайский (Cervus elaphus sibiricus) GATGAATGGAAGAAGAAAGTCAGTGAATCTTATGTTATTGTAATAGAAAGATTAG AAGATGACCTGCAGATCAAAGAAAAAGAACTTACAGAACTGAGGCATATATTTGG G

Pages:     | 1 | 2 ||
 





 
© 2013 www.libed.ru - «Бесплатная библиотека научно-практических конференций»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.