авторефераты диссертаций БЕСПЛАТНАЯ БИБЛИОТЕКА РОССИИ

КОНФЕРЕНЦИИ, КНИГИ, ПОСОБИЯ, НАУЧНЫЕ ИЗДАНИЯ

<< ГЛАВНАЯ
АГРОИНЖЕНЕРИЯ
АСТРОНОМИЯ
БЕЗОПАСНОСТЬ
БИОЛОГИЯ
ЗЕМЛЯ
ИНФОРМАТИКА
ИСКУССТВОВЕДЕНИЕ
ИСТОРИЯ
КУЛЬТУРОЛОГИЯ
МАШИНОСТРОЕНИЕ
МЕДИЦИНА
МЕТАЛЛУРГИЯ
МЕХАНИКА
ПЕДАГОГИКА
ПОЛИТИКА
ПРИБОРОСТРОЕНИЕ
ПРОДОВОЛЬСТВИЕ
ПСИХОЛОГИЯ
РАДИОТЕХНИКА
СЕЛЬСКОЕ ХОЗЯЙСТВО
СОЦИОЛОГИЯ
СТРОИТЕЛЬСТВО
ТЕХНИЧЕСКИЕ НАУКИ
ТРАНСПОРТ
ФАРМАЦЕВТИКА
ФИЗИКА
ФИЗИОЛОГИЯ
ФИЛОЛОГИЯ
ФИЛОСОФИЯ
ХИМИЯ
ЭКОНОМИКА
ЭЛЕКТРОТЕХНИКА
ЭНЕРГЕТИКА
ЮРИСПРУДЕНЦИЯ
ЯЗЫКОЗНАНИЕ
РАЗНОЕ
КОНТАКТЫ

Pages:     | 1 |   ...   | 3 | 4 || 6 | 7 |

«Международная Школа-конференция молодых ученых «Биотехнология будущего» организована Институтом биохимии им. А.Н.Баха РАН в рамках Симпозиума «ЕС-Россия: перспективы сотруд- ничества в ...»

-- [ Страница 5 ] --

MA113: 1 M------ MA32: 1 MS----- B23: 1 MSTSIST MA113: 2 TAT-STPGERARALFAVLKRKDLIPEGYIEQLTQLMEHGWSPENGARIVAKAWVDPQFRE MA32: 3 TAT-STPGERAWALFQVLKSKELIPEGYVEQLTQLMEHGWSPENGARVVAKAWVDPQFRA B23: 8 TATPSTPGERAWALFQVLKSKELIPEGYVEQLTQLMAHDWSPENGARVVAKAWVDPQFRA MA113: 61 LLLKDGTAACAQFGFTGPQGEYIVALEDTPQLKNVIVCSLCSCTAWPVLGLPPEWYKGFE MA32: 62 LLLKDGTAACAQFGYTGPQGEYIVALEDTPTLKNVIVCSLCSCTNWPVLGLPPEWYKGFE B23: 68 LLLKDGTAACAQFGYTGPQGEYIVALEDTPGVKNVIVCSLCSCTNWPVLGLPPEWYKGFE MA113: 121 FRARLVREGRTVLRELGTELPGDMVVKVWDTSAESRYLVLPQRPAGSEHMSEEQLRQLVT MA32: 122 FRARLVREGRTVLRELGTELPRDMVVKVWDTSAESRYLVLPVRPEGSEHMSEEQLQALVT B23: 128 FRARLVREGRTVLRELGTELPSDTVIKVWDTSAESRYLVLPQRPEGSEHMSEEQLQQLVT MA113: 181 KDVLIGVALPRVG MA32: 182 KDVLIGVALPRVG B23: 188 KDVLIGVALPRVG MA113: 1 MDGFHDLGGFQGFGKVPHRINSLSYKQAFKQDWEHLAYSLMFIGVDHLNKFSVDEIRHAV MA32: 1 MDGFHDLGGFQGFGKVPHTINSLSYKQVFKQDWEHLAYSLMFIGADHLKKFSVDEVRHAV B23 : 1 MDGFHDLGGFQGFGKVPHTINSLSYKQVFKQDWEHLAYSLMFVGVDQLKKFSVDEVRHAV MA113: 61 ERIDVRQHVGTEYYERYVIATATLLVETGVITQAELDEALGSHFKLANPAHAQGRAAIIG MA32: 61 ERLDVRQHVGTQYYERYVIATATLLVETGVITQAELDQALGSHFKLANPAHAEGRPAITG B23 : 61 ERLDVRQHVGTQYYERYIIATATLLVETGVITQAELDQALGSHFKLANPAHATGRPAITG MA113: 121 RAPFEVGDRVIVRDEYVAGHVRMPAHVRGKQGVVLHRTTEQWPFPDAIGHGDQSAAHQPT MA32: 121 RPPFEVGDRVVVRDEYVAGHIRMPAYVRGKEGVVLHRTSEKWPFPDAIGHGDVSAAHQPT B23 : 121 RPPFEVGDRVVVRDEYVAGHIRMPAYVRGKEGVVLHRTSEQWPFPDAIGHGDLSAAHQPT MA113: 181 YHVEFRVRDLWGDAADDGLVVVDLFESYLDRVESPRVVRA MA32: 181 YHVEFAVKDLWGDAADEGFVVVDLFESYLDKAAGARAV-N B23 : 181 YHVEFRVKDLWGDAADDGYVVVDLFESYLDKAPGAQAV-N Рис.4: Сравнение аминокислотных последовательностей генов исследуемых НГ.

Литература (1) International Patent Application PCT/EP2005/002689 corresponding to the German Patent Application № 10 2004 847.8 “Cyanidtolerante Nitrilhydratasen”, 2005.

(2) Gerasimova T., Novikov A., Osswald S., Yanenko A.: Screening, Characterization and Application of Cyanide-resistant Nitrile Hydratases. (2004) Engineering in Life Sciences,Vol.4, №6, 543-546.

(3) Nagasawa T., Nanba H., Ryuno K., Takeuchi K., Yamada H.: Nitrile hydratase of Pseudomonas chlororaphis B23 – Purification and characterization. (1987) Eur. J. Biochem., 162, 691-698.

НОВЫЕ ФЛУОРЕСЦЕНТНЫЕ ЗОНДЫ НА ОСНОВЕ ОЛИГО(2’-О-МЕТИЛРИБОНУКЛЕОТИДОВ) ПРЕЦИЗИОННЫЕ ИНСТРУМЕНТЫ МОЛЕКУЛЯРНОЙ БИОТЕХНОЛОГИИ Новопашина Д.С.





Институт химической биологии и фундаментальной медицины, 630090 Новосибирск, проспект Лаврентьева, 8, Россия danov@niboch.nsc.ru Ключевые слова: олиго(2’-О-метилрибонуклеотиды), пирен, флуоресцентные зонды, детекция нуклеиновых кислот 1. Введение Олигонуклеотиды и их производные находят широкое применение в молекулярной биотехнологии, химической биологии и фундаментальной медицине. Флуоресцентно меченые олигонуклеотиды используются в настоящее время как зонды для слежения за внутриклеточными процессами, для мониторинга НК гибридизации, в качестве праймеров при секвенировании ДНК и др. (1,2). Целью данной работы является конструирование новых флуоресцентных зондов - моно- и бис- пиренильных конъюгатов олиго(2’-О метилрибонуклеотидов), и изучение их гибридизационных и флуоресцентных свойств.

2. Материалы и методы В работе были использованы реактивы и растворители производства Glen Research (США), Fluka (Швейцария), Merck (Германия), Aldrich (Германия), ICN (США). 5’-Фосфатсодержащие олиго(2’-О метилрибонуклеотиды) были синтезированы твердофазным фосфитамидным методом на синтезаторе ASM 102U (“Биоссет", Новосибирск, Россия). 2’-Фосфатсодержащие олиго(2’-О-метилрибонуклеотиды) получены по разработанному нами методу (3). Температуры плавления дуплексов определяли на установке с терморегулируемой оптической кюветой на базе УФ-детектора жидкостного хроматографа “Милихром” (Научприбор, Россия). Спектры флуоресценции записывали на Kontron Instrument SFM 25 (Kontron, Италия).

3. Результаты и обсуждение В качестве основы для создания флуоресцентных зондов нами были выбраны олиго(2’-О метилрибонуклеотиды) и их аналоги, содержащие 3’-концевую “инвертированную” (3’-3’) межнуклеотидную связь. Для них характерна высокая аффинность к НК, высокая скорость гибридизации, способность связываться со структурированной РНК и дискриминировать мисматчи, а также исключительная стабильность к нуклеазам (4,5). Введение функциональных группировок как в 5’-, так и в 2’-положение вызывает минимальное искажение структуры дуплекса при гибридизации с комплементарной мишенью.

Функционализация олигонуклеотида по 2’-положению дает возможность введения группировки в любой нуклеозид олигонуклеотида, направленное расположение присоединяемого лиганда в малой бороздке дуплекса и бльшую чувствительность вводимой группировки к структуре дуплекса.

O 1. PPh3, Py2S2, DMAP / DMSO 1. PPh3, Py2S2, DMAP / DMSO -O P O Oligo 15 мин, 370С 15 мин, 370С 2. PyrCH2NH2*HCl / TEA / DMSO 2. осаждение 2% LiClO O 16 ч, 370С 3. H2O / PyrCH2NH2*HCl / TEA / DMSO 3. офВЭЖХ 2 ч, 370C 4. офВЭЖХ CH O H NH Oligo NPO Oligo C CN PO O H2 H2 H O O Oligo - 2'- или 5'-фосфатсодержащий олиго(2'-О-метилрибонуклеотид) OPO O Рисунок 1: Схема синтеза моно- и бис-пиренильных конъюгатов олиго(2’-О-метилрибонуклеотидов).

Для введения остатков пирена в олиго(2’-О-метилрибонуклеотиды) использовали метод активации 2’- или 5’-фосфата незащищенного олигонуклеотида окислительно-восстановительной парой трифенилфосфин дипиридилдисульфид в присутствии 4-N,N’-диметиламинопиридина как нуклеофильного катализатора (3,6).

Последующее взаимодействие с аминосодержащим производным пирена в различных условиях (7,8) приводит как моно-, так и к бис- пиренильным производным олигонуклеотидов (Рис.1, Табл.1).





Таблица 1: Характеристики пиренсодержащих конъюгатов.

Tпл, 0С (Tпл, ОС)2* MALDI TOF анализ Конъюгат Рассчитано/Найдено РНК ДНК RpGmCmAmUmCmAmAmGmCmUmCmCmAmGmGmdC 73.1 (+7.9) 3* 5566.76/ 5561. R2pGmCmAmUmCmAmAmGmCmUmCmCmAmGmGmd 70.5 (+5.3) 3* 5780.03/ 5791.731* C GmCmAmUmCmAmAmGmCmUpRCmCmAmGmGmdC 5552.73/ 69.4 5568.691* (+6.2) 3* m m mm mmm m RpC A G C U C C A 2874.01/ 62.5 46. (+6.7) 4* (+10.1) 5* 2873. R2pCmAmGmCmUmCmCmAm 3087.29/ 57.8 40. (+2.0) 4* (+4.4) 5* 3087. RpCmAmGmCmUmCmCmAm3’-3’T 3178.21/ 65.1 44. (+8.1) 4* (+11.5) 5* 3177. R2pCmAmGmCmUmCmCmAm3’-3’T 3391.48/ 59.5 42. (+2.5) 4* (+9.5) 5* 3390. R=PyrCH2NH;

p – фосфат;

1*- содержат 2 иона Li+;

2*- Тпл между комплексами исходного олигонуклеотида или конъюгата с мишенью;

3*- РНК-мишень 5’-GCC UGG AGC UUG AUG C;

4*- РНК-мишень 5’-GUCGAGGU;

5* ДНК-мишень 5’-GTCGAGGT.

Методом термической денатурации дуплексов было показано, что введение остатков пирена в олиго(2’-О метилрибонуклеотиды) повышает их комплексообразующие свойства (Табл.1). Продемонстрирована высокая чувствительность флуоресценции синтезированных пиренильных конъюгатов при образовании дуплексов с комплементарными фрагментами РНК и ДНК. Флуоресцентные свойства конъюгатов зависят от числа и положения остатков пирена в олигонуклеотиде, а также типа комплементарного олигонуклеотида. 5’-Бис пиренильные конъюгаты олиго(2’-О-метилрибонуклеотидов) чувствительны к гибридизации с НК, при этом происходит сильное разгорание эксимерной флуоресценции (в 6 раз), и менее заметное разгорание мономерной флуоресценции (в 1.5 раза). При связывании 5’-моно-пиренильных конъюгатов олиго(2’-О метилрибонуклеотидов) наблюдали ярко выраженное тушение мономерной флуоресценции независимо от типа комплементарного олигонуклеотида (Рис.2). 2’-Монопиренильный конъюгат оказался селективным зондом для РНК. Мы наблюдали возрастание мономерной флуоресценции в 5 раз при его связывании с комплементарным фрагментом РНК и незначительное изменение при образовании дуплекса с ДНК (Рис.2).

RpGmCmAmUmCmAmAmGmCmUmCmCmAmGmGmdC GmCmAmUmCmAmAmGmCmUpRCmCmAmGmGmdC 35 30 флуоресценции, усл.ед флуоресценции, усл.ед 25 Интенсивность Интенсивность 10 5 3 360 380 400 420 440 460 480 360 380 400 420 440 460 480 500 Длина волны, нм Длина волны, нм Рисунок 2: Спектры флуоресценции 5’- и 2’-моно- пиренильных конъюгатов (кривые 1 и 4) и их комплексов с комплементарными фрагментами ДНК (кривые 2 и 5) и РНК (кривые 3 и 6).

4. Заключение Полученные результаты позволяют сделать вывод о том, что созданные на основе олиго(2’-О метилрибонуклеотидов) устойчивые в биологических средах флуоресцентные конъюгаты являются перспективными инструментами молекулярной биотехнологии и могут быть использованы для детекции НК in vitro и in vivo и для изучения их пространственной структуры.

Благодарность Авторы благодарят Пышного Д.В. и Ломзова А.А. (ИХБФМ СО РАН) за получение дифференциальных кривых термической денатурации дуплексов, Коваля В.В. (ИХБФМ СО РАН) за регистрацию масс-спектров, а также Стеценко Д.А. (University of Surrey, UK) за обсуждение результатов работы. Работа поддержана РФФИ (N 05-04-48341), INTAS (N 03-51-5281) и Лаврентьевским конкурсом молодежных проектов СО РАН.

Литература (1) Dirks R.W. et al. (2003) Methods, 29, 51-57.

(2) Mahara A. et al. (2003) Bioorg. Med. Chem., 11, 2783-2790.

(3) Novopashina D.S. et al. (2005) Nucleosides Nucleotides Nucl. Acids, 24, 729-734.

(4) Majlessi, W. et al. (1998) Nucleic Acids Res., 26, 2224-2229.

(5) Novopashina D.S. et al. (2005) Nucleosides Nucleotides Nucl. Acids, 24, 527-531.

(6) Zarytova V. et al. (1998) Nucleosides Nucleotides, 17, 649-662.

(7) Grimm, G.N. et al. (2000) Nucleosides Nucleotides Nucl. Acids, 19, 1943-1965.

(8) Kostenko, E. et al. (2001) Nucleic Acids Res., 29, 3611-3620.

ИССЛЕДОВАНИЕ ЭКСПЕРИМЕНТАЛЬНОГО ПРЕПАРАТА НА ОСНОВЕ МИКОБАКТЕРИАЛЬНОГО АНТИГЕНА ESAT Носарева О.В., Нестеров А.Е., Болдырев А.Н., Смирнова О.Ю., Туманов Ю.В., Татьков С.И.

ФГУН ГНЦ ВБ «Вектор» «Роспотребнадзора», 630559, Кольцово, Новосибирская область, Россия nosarevao@mail.ru Ключевые слова: туберкулёз, рекомбинантные антигены, ДНК-вакцина Введение Туберкулёз (ТБ) остаётся одной из главных причин смерти от инфекционных заболеваний человека. В настоящее время широко используется вакцина BCG, иммунологическая эффективность которой варьирует в широких пределах, как у человека, так и у животных (2,6). Поэтому существует острая необходимость улучшения вакцины BCG или создания эффективных альтернативных вакцин для профилактики туберкулеза.

Исследование и сравнение геномов микобактерий способствовало выявлению интересного геномного участка RD1, который отсутствовал во всех аттенуированных вакцинных штаммах M.bovis BCG, но обнаруживался во всех вирулентных штаммах M.tuberculosis и M.bovis (1,3). Недавние исследования показали, что белок ESAT6, кодируемый RD1 областью M. tuberculosis, является многообещающим кандидатом для противотуберкулёзных вакцин. Антиген ESAT6 является мощной иммунодоминантной мишенью для клеточного иммунного ответа как на ранней стадии инфекции у человека, так и в различных животных моделях ТБ (3,4).

Исследование и оценка этого антигена в качестве ДНК-вакцины с модифицированным полисахаридным коньюгатом может помочь в разработке противотуберкулёзных вакцин (5). Для выполнения поставленной цели был получен экспериментальный препарат в виде плазмидной ДНК pcDNA3.1mycHis(-)/lacZ/ESAT6, защищённой полисахаридной оболочкой, и проверен на мышиной модели иммунизации.

Получение рекомбинантного белка Для получения рекомбинантного белка GST-ESAT6 ген esxA из M.tuberculosis H37Rv был амплифицирован и клонирован экспрессионный вектор pGEX-2T с использованием сайтов рестрикции BamHI и EcoRI.

Смысловой 5*-праймер 5’- GAGGATCCATGACAGAGCAGCAGTGG и антисмысловой 3*-праймер 5’ – GCGAATTCTAAACACGAGAAAGGGCG. О наличие встройки гена в плазмиду свидетельствовало образование ампликона соответствующего размера -388 п.о. Структура полученной конструкции была подтверждена рестрикционным анализом. Гибридный белок GST-ESAT6 был наработан культуре клеток E.coli BL21 и выделен с помощью аффинной хроматографии на глутатион-сефарозе 4В. Молекулярная масса гибридного полипептида составила около 30 кДа, что соответствовало ожидаемой. Вестерн-блот подтвердил иммунореактивность полученного белка с моноклональными антителами к GST, а также с сыворотками от пациентов с активной формой туберкулёза.

Конструирование ДНК-вакцины Для получения плазмиды pcDNA3.1mychislacZ(-)/ESAT6 проводили амплификацию последовательности гена esxA из геномной ДНК Смысловой 5*-праймер 5’ M.tuberculosis H37Rv.

GAGGATCCATGACAGAGCAGCAGTGG, содержащий старт-кодон и сайт клонирования - BamHI, и антисмысловой 3*-праймер 5’–GGCAAGCTTATAAACACGAGAAAGGGC, содержащий стоп-кодон и сайт клонирования - HindIII. Полученный ПЦР - продукт (361 п.о.) был обработан эндонуклеазами рестрикции BamHI и клонирован в эукариотическую экспрессионную плазмиду pcDNA3.1mycHis(-)/lacZ. Структура полученной конструкции была подтверждена рестрикционным анализом и секвенированием методом Сенгера.

Получение экспериментальных препаратов Для получения экспериментальных препаратов мы решили использовать широко применяемые в медицинской практике полисахариды (2). Модифицированные полисахариды, имеющие альдегидные группы, приобретают свойство полимера-носителя. Для получения полиальдегиддекстрана (ПАД) полиглюкин обрабатывали периодатом натрия. Затем активированный полисахарид смешивали со спермидином в эквимолярных соотношениях, инкубировали в течение ночи при 4 0С. Непрореагировавшие компоненты удаляли гель-фильтрацией на колонке с сефадексом G-50 (V = 20 мл).

Для создания экспериментальной конструкции, содержащей рекомбинантную плазмиду pcDNA3.1mychislacZ(-)/ESAT6, смешивали плазмидную ДНК с полученным конъюгатом. Для создания контрольного препарата, содержащего нативную плазмиду pcDNA3.1mychislacZ(-) без встройки гена, смешивали плазмидную ДНК с полученным конъюгатом.

Для проверки полноты упаковки нуклеотидного материала в собранной конструкции проводили её обработку ДНКазой (0.05 мг/мл). Опыт показал, что если для исходной плазмидной ДНК полная деградация наблюдалась уже через 30 минут инкубации, то в собранной конструкции нуклеотидный материал сохранялся интактным в течение 24 часов.

Иммунизация животных Изучение иммуногенных свойств экспериментального препарата проводили на мышах линии BALB/c в возрасте 6-8 недель, массой 16-18 г из питомника ГНЦ ВБ «Вектор». Эксперименты на животных проводились в соответствии с требованиями (РД 42-28-8-89) биоэтических норм. 60 мышей были разделены на 2 группы случайным образом. Экспериментальный препарат ПАД-pcDNA3.1mychislacZ(-)/ESAT6 вводили в/м трехкратно с 2-х недельным интервалом в объеме 0,2мл на животное (содержание ДНК 50мкг в дозе). В качестве контроля использовали мышей, инъецированных препаратом с плазмидой ПАД pcDNA3.1mychislacZ(-) в тех же дозах и по той же схеме иммунизации.

Иммунологические свойства экспериментальных препаратов Результаты исследования острой токсичности препарата (в соответствии с требованиями РД 42-28-8-89) показывают, что испытуемая генетическая конструкция в избранной форме, дозе и способе применения не вызывает снижение веса и каких-либо расстройств здоровья у используемых животных и не обладают «острой» токсичностью.

Оценку показателей клеточного иммунитета проводили в реакции бласттрансформации лимфоцитов, определяющей пролиферативный потенциал лимфоцитов в ответ на действие специфического антигена GST ESAT6. В РБТЛ зафиксирована положительная динамика показателей пролиферативной активности спленоцитов при стимуляции GST-ESAT6. В контрольных группах мышей, иммунизированных плазмидами ПАД - pcDNA3.1mychislacZ(-), не экспрессирующими ESAT6, не отмечалось выраженной пролиферации активности в ответ на стимуляцию специфическим антигеном.

Иммунизация мышей экспериментальным препаратом pcDNA3.1mycHis(-)/lacZ/ESAT6, окружённым полисахаридным коньюгатом, вызывало формирование иммунореактивных спленоцитов, которые уже на неделе после иммунизации способны были отвечать на специфичный антиген GST-ESAT6 индукцией гамма ИФН в ELISPOT.

Заключение Таким образом, был получен экспериментальный препарат в виде плазмидной ДНК pcDNA3.1mychislacZ(-), кодирующей ESAT6 антиген, окруженный полисахаридной оболочкой, которая защищает нуклеиновые кислоты от деградации под действием ДНКаз. На мышиной модели экспериментальный препарат показал отсутствие «острой» токсичности и наличие иммуногенных свойств, проявляющихся выраженной стимуляцией клеточного иммунного ответа. В будущем планируется проверить протективные свойства полученного препарата на мышиной модели туберкулёза.

Благодарность Выражаем огромную благодарность профессору Г.М. Игнатьеву и Г.А. Кузьмичёвой за участие в обсуждении результатов и ценные советы.

Литература (1) Brusasca PN, Colangeli R et. al.: Immunological characterization of antigens encoded by the RD1 region of the Mycobacterium tuberculosis genome.(2001) Scand J Immunol., 54(5), 448-452.

(2) Howard Engers, Marie Paule Kieny et. al.: Third meeting on Novel Adjuvants Currently in or Close to Clinical Testing World Health Organization. (2003) Vaccine, 21, 3503-3524.

(3) Jungblut PR, Schaible UE et. al.: Mycobacterium tuberculosis operon encoding ESAT-6 and a novel low-molecular-mass culture filtrate protein (CFP10). (1999) Mol Microbiol.,33(6), 1103-1117.

(4) Martin J. Elhay, Thomas Oettinger, Peter Andersen: Delayed-type hypersensitivity responses to ESAT6 and MPT64 from Mycobacterium tuberculosis in guinea pig. (1998) Infection and Immunity, Vol 66, №7, 3454-3456.

(5) Masato Uchijima, Atsushi Yoshida, Toshi Nagata, and Yukio Koide:Optimization of Codon Usage of Plasmid DNA Vaccine Is Required for the Effective MHC Class I-Restricted T Cell Responses Against an Intracellular Bacterium(1998) J. Immunol., 161, 5594 - 5599.

(6) Mustafa A.S.: Biotechnology in the development of new vaccines and diagnostic reagents against tuberculosis. (2001) Curr Pharm Biotechnol., 2, 157-173.

ИММУНОЛОГИЧЕСКИЕ И ФИЗИКО-ХИМИЧЕСКИЕ ОСНОВЫ СОЗДАНИЯ БИОСЕНСОРА НА СОДЕРЖАНИЕ БАКТЕРИЙ В ПИТЬЕВОЙ ВОДЕ Погорелова Л.В.

Институт прикладной механики РАН, 119991, г. Москва, Ленинский проспект, д.32А iam@ipsun.ras.ru Ключевые слова: биосенсоры, иммунохроматография, пористые носители 1. Введение Стихийные бедствия и антропогенные катастрофы приводят как к локальным, так и обширным загрязнениям окружающей среды, в частности, источников воды. Своевременное обнаружение таких загрязнений – актуальная задача. Одной из проблем, стоящих перед санитарной службой, является обнаружение в источниках питьевой воды санитарно значимых возбудителей инфекций, или микроорганизмов, сопутствующих им. При повреждении системы водоснабжения в случае природных экстремальных явлений, а также при террористических актах, антропогенных катастрофах и халатном содержании очистных сооружений их содержимое может попадать в питьевую воду.

Как отмечено в работе [1], c 1995 года формируется новое междисциплинарное научно-технологическое направление под условным названием "Сенсорная биология и новые сенсорные технологии". Задачи направления: сравнить возможности сенсорных систем организмов (органов чувств) и биосенсоров, установить, реально ли применение современных знаний о принципах создания новых сенсорных технологий.

2. Материалы и методы В настоящей работе исследовалась эффективность новой системы для экспресс-обнаружения санитарно значимых бактерий в воде [2]. На начальном этапе было проведено сравнение физических методов распознавания бактерий (использование селективной проводимости для распознавания запахов или газовой хроматографии с использованием ультразвуковой детекции на основе кварцевого резонатора), молекулярно биологических (полимеразная цепная реакция и ДНК – гибридизация in situ дезоксирибонуклеиновых кислот) и иммунохроматографического анализа (ИХА). Однако попытка выявить антиген (АГ) в растворе при помощи обычной реакции ИХА оказалась неудачной. Возможно, это связано со стерическим экранированием сайтов связывания моноклонального АТ против пероксидазы хрена при сорбции на коллоидном золоте. В нашей работе совместно с НИИ Морфологии человека РАМН использовали сочетание моноспецифических и моноклональных антител. Моноспецифические антитела (МСАТ) к Е.coli были иммобилизованы в тест-зоне ИХ-полоски (стрипа), на нитроцеллюлозной мембране, реагировали с антигенами (АГ) Е.coli в образце воды в процессе тангенциального перемещения образца воды по тест-полоске. Одновременно происходило связывание конъюгата (КГ) МСАТ с пероксидазой хрена (ПХ) и конъюгата моноклональных антител (МКАТ) к пероксидазе хрена (ПХ) с наночастицами коллоидного золота (КнЧ). В результате в тест-зоне образуется комплекс МСАТ-АГ- КГМСАТ ПХ-КГ МКАТ КнЧ. Образовавшийся комплекс позволяет визуализовать наличие АГ Е.coli и в течение нескольких минут обнаружить наличие бактерий.

Исследовали эффективность реакции на обнаружение бактерий с помощью вышеописанного четырехслойного иммунохроматографического анализа с применением прибора - сканирующего спектрофотометра марки Stat Fax 2100 (Awareness Technology Inc.).

Для постановки реакции использовали «сендвич»-вариант иммуноферментного анализа. На дно ячеек в полистироловых планшетах спектрофотометра наносили АТ к Е.coli концентрации 10мкг/мл. Сайты неспецифического связывания блокировали однопроцентным раствором альбумина, затем наносили АТ к Е.coli в разведениях, инкубировали 1 час при 37° и, после отмывки, вносили коньюгат моноспецифических АТ к Е.coli, меченных пероксидазой. В лунки добавляли по 100 мкл раствора следующего состава:

1.Тетраметилбензидин с концентрацией 1,4 г/л в диметилсульфоксиде (20%) 2.Раствор 0,02% раствора Н2О2 на 50 мМ цитратно-фасфатном буфере с рН 4,7 (80%). Реакцию инкубировали 20 минут в темноте, затем реакцию останавливали добавлением в лунки 50 мкл 50% Н2SО4. При этом, цвет окраски менялся с синего на желтый, реакцию учитывали на спектрофотометре при длине волны 450 нм. Одновременно разрабатывались методики анализа структуры мембран из нитрата целлюлозы до и после реакции и сопоставлялись данные по структуре агломератов наночастиц коллоидного золота.

3. Результаты и обсуждение В тест-зоне наблюдалось образование комплекса МСАТ-АГ- КГМСАТ ПХ-КГ МКАТ КнЧ («заякоривание» комплекса). Образовавшийся комплекс позволяет визуализировать наличие АГ Е.coli и в течение нескольких минут обнаружить наличие бактерий.

Анализ данных микроскопии показывает, что визуализация комплекса происходит не с помощью увеличения концентрации диффузно-распределенных частиц коллоидного золота в тест-зоне, а путем образования более крупных конгломератов. Ранее после реакции с помощью растровой электронной микроскопии хорошо различимо появление конгломератов диаметром 10-15 мкм ассоциированных с нитроцеллюлозой. Их количество составляет примерно 20000 на см2. Очевидно, этого количества достаточно для оптической визуализации сигнала на иммунохроматограмме. Так как размер частиц коллоидного золота составляет 30-50 нм, то представляется очевидным, что основной вклад в визуализацию тест-полосы вносят конгломераты, а не диффузно распределенные коллоидные частицы.

При изменении концентрации бактерий в питьевой воде была показана возможность дозозависимого определения Е.coli в данной системе.

Полученные результаты сопоставлены с полученными ранее данными о роли взаимодействия растворов биополимеров - растворов белков, содержащих антитела - с пористым полимерным носителем – мембраной из нитрата целлюлозы [3]. Установлено, что конструирование биоактивных композитов (в данном случае биосенсоров) возможно лишь после всестороннего изучения процесса формирования контакта жидких сред с матрицей пористого носителя.

Результаты работы подтверждают вывод авторов работ [1,4-6] о том, что создание биосенсоров имеет принципиально многодисциплинарный характер и непосредственно связано с исследованием свойств биополимеров и механизмом формирования биокомпозитов.

4. Заключение Таким образом, в работе показана возможность создания многослойного варианта комплекса «антиген – антитело». Сконструирована и экспериментально опробована в лабораторных условиях четырехслойная иммунохромотографическая система, состоящая из следующих компонентов: 1 слой моноспецифических АТ против Е.coli;

2 слой - исследуемая жидкость, содержащая Е.coli;

3 слой - коньюгат моноспецифического АТ к Е.coli с пероксидазой хрена;

4 слой - коньюгат коллоидного золота (размер частиц 30 нм) с моноклональными АТ к пероксидазе хрена.

Благодарность Благодарю своих руководителей – д.б.н. Н.С.Снегиреву и к.ф.-м.н. Ю.Н.Карнет;

Благодарю к.б.н.

Е.И.Зарайского, предоставившего мне данные по размерам агломератов коллоидных наночастиц, и моих товарищей по ИПРИМ РАН, помогавших мне в освоении методов микроскопии – Валентина Жогина и Алексея Яровицина.

Литература (1) С.Д. Варфоломеев, Ю.М. Евдокимов, М.А. Островский.. Вестник российской академии наук, том 70, № 2, г., с. 99-108.

(2) Ковалев Г.Н., Яновский Ю.Г., Карнет Ю.Н., Зарайский Е.И., Снегирева Н.С., Образцов И.Ф. Новая технология получения специфичных антител к Escherichia coli при разработке изделий для экологического мониторинга //Экологический вестник научных центров Черноморского Экономического Сотрудничества, 2004 №2, с.61- (3) Образцов И.Ф., Яновский Ю.Г., Карнет Ю.Н., Ковалев Г.Н., Зарайский Е.И., Снегирева Н.С. О некоторых особенностях фазовой перколяции в пористых системах. Экологический вестник научных центров Черноморского Экономического Сотрудничества, 2004, №4, с.39-46.

(4) Госреестр открытий СССР, открытие № 316, приоритет от 1978 г.;

авторы: И.В. Березин, В.А. Богдановская, С.Д.

Варфоломеев, М.Р. Тарасевич, А.И. Ярополов (5) Блинцов А.Н., Снегирева Н.С., Бобкова А.Ф., Дзантиев Б.Б., Изумрудов В.А. Ферментативный иммунохроматографический анализ растительных вирусов. ДАН, том 356, №2 (сентябрь 1997),с. 264-267.

(6) Ковалев Г.Н., Снегирева Н.С. Биологически активные композиционные материалы. В кн. Труды школы-семинара « Композиционные материалы» М., РАН, ИПРИМ РАН, 2000, с. 12-25.

РОЛЬ ФИТОХРОМНОЙ СИСТЕМЫ В РЕГУЛЯЦИИ АКТИВНОСТИ СУКЦИНАТДЕГИДРОГЕ НАЗЫ ЗЕЛЕНЫХ ЛИСТЬЕВ МУТАНТОВ ARABIDOPSIS THALIANA L.

Попов В.Н.

Кафедра физиологии и биохимии растений, Воронежский государственный университет, 394693 Воронеж, Университетская пл., 1, Россия pvn@bio.vsu.ru Ключевые слова: Красный свет, дальний красный свет, регуляция, сукцинатдегидрогеназа, фитохром, мутанты 1. Введение Свет в жизнедеятельности растений является не только одним из основных факторов протекания фотосинтетического процесса, но и играет важную роль в регуляции роста и формообразования растений.

Несомненный интерес для исследования механизмов действия света на ферменты ЦТК представляет изучение действия этого фактора на сукцинатдегидрогеназу. СДГ (сукцинат: убихинон оксидоредуктаза) – это мембранный белковый комплекс, одновременно обеспечивающий функционирование ЦТК и ЭТЦ, и поэтому изучение влияния света на этот фермент позволит выявить механизмы регуляции окислительных процессов на ферментативном, мембранном и метаболическом уровнях. Целью нашей работы являлось изучение влияния смешанного, красного и дальнего красного света на активность сукцинатдегидрогеназы и выявление возможного участия фитохромной системы в регуляции этого фермента.

2. Материалы и методы В работе использовали 24-дневные проростки Arabidopsis thaliana L., выращенных в почве по стандартной методике при 16 часовом световом дне с интенсивностью света 25 Дж/ м2с. Действие красного и дальнего красного света на активность сукцинатдегидрогеназы было рассмотрено на 3х линиях растений Arabidopsis thaliana: дикого типа (WT CoL-0), мутанта по гену фитохрома А (PHYA-201), мутанта по гену фитохрома В (PHYB-1). В качестве контрольных растений использовали зеленые проростки, подвергнутые 24 часовой инкубации в темноте. Опытные растения облучали светом с длинной волны 660 нм (красный свет) и 730 нм (дальний красный свет) в течение 15 минут. Интенсивность света составляла 0,044 Дж/м2с. Красный и дальний красный свет получали с помощью светодиодов и светофильтров с областью испускания 640-680нм и 710-750нм.

3. Результаты и обсуждение При исследовании влияния белого света на активность сукцинатдегидрогеназы в зеленых листьях A.

thaliana установлено, что при помещении зеленых проростков, подвергшихся 24-часовой инкубации в темноте, в первые полчаса инсоляции происходило возрастание активности СДГ в 1,4. Затем в течение следующих двух часов выявлялось резкое снижение активности фермента. Далее активность фермента стабилизировалась, и после 9 часов освещения составила 51 % от контроля.

Для изучения возможного участия фитохромной системы в регуляции активности сукцинатдегидрогеназы в зеленых листьях был проведен анализ влияния низкоэнергетического красного и дальнего красного света, рецептируемых фитохромами, на активность СДГ в зеленых растениях A. thaliana трех мутантных линий. На рисунке изображена выявленная зависимость активности СДГ от действия света разной длинны волны на растения A. thaliana дикого типа. Показано, что под влиянием красного света (660нм) происходило снижение активности фермента в 6 раз относительно контрольного уровня (24 часа в темноте). Сходная картина наблюдалась и в растениях A. thaliana мутантных по гену фитохрома В (рис.). В этом варианте активность СДГ уменьшалась под действием красного света в 4,8 раза. В тоже время действие красного света не вызывало достоверных изменений активности фермента в линии A. thaliana, в которых отсутствует ген, кодирующий фитохром А (рис.). Такое падение активности сукцинатдегидрогеназы в A. thaliana WT Col-0 и в мутантной линии A. thaliana PHYВ-1, а также отсутствие изменений в активности фермента под действие красного света Рисунок: Активность СДГ в зеленых растениях арабидопсиса трех мутантных линий при облучении красным светом.

А – растения A. thaliana дикого типа. Б – растения A.

thaliana, мутантного по гену фитохрома А. В – растения A.

thaliana, мутантного по гену фитохрома В.

К – активность контрольных растений, выдержанные 24 часа в темноте;

660 – активность растений через 24 часа после 15 минут облучения низкоэнергетическим светом с длинной волны 660 нм.;

730 - активность растений через 24 часа после минут облучения низкоэнергетическим светом с длинной волны 730 нм;

660+730 – активность растений после 24 часов инкубации в темноте с последующим последовательным облучением низкоэнергетическим светом с длинной волны 660 нм и 730 нм в течение 15 минут.

в растениях линии A. thaliana PHYA-201 позволило сделать вывод, что в световой регуляции функционирования СДГ принимает участие фитохром А. Воздействие на растения всех трех линий A. thaliana дальнего красного света имело реципрокный красному свету эффект на работу фермента. При облучении дальним красным светом активность СДГ не изменилась относительно контрольного уровня в диком типе и в мутанте по гену фитохрома В, в мутанте по гену фитохрома А активность увеличилась в 1,7 раза.

Последовательное действие на растения красного и дальнего красного света вызывало аналогичный эффект с дальним красным светом (Рисунок). Поскольку при действии дальнего красного света и последовательном действии красного и дальнего красного света не происходило угнетения активности сукцинатдегидрогеназы во всех трех линиях A. thaliana, утверждать, что дальний красный свет является антагонистом красного света.

Свет является ключевым фактором, регулирующим биоэнергетику зеленых растений. Интенсивность протекания фотосинтетических и дыхательных процессов в клетке должна быть сбалансирована и определяться световым режимом. На свету основным источником ATP для фотосинтезирующей клетки является работа электронтранспортной цепи хлоропластов, а при переходе в темноту в энергообеспечении клетки увеличивается роль митохондрий, окисляющих карбоновые и жирные кислоты в процессе темнового дыхания. Торможение интенсивным светом сукцинатдегидрогеназной реакции скорее всего связано с тем, что по мере увеличения интенсивности и активации реакций фотофосфорилирования роль дыхания в общем энергетическом обеспечении клетки резко снижается. Возможным механизмом изменения активности СДГ может быть участие специальных фоторецепторных систем, характерных для растений. Полученные данные о влиянии низкоэнергетического красного и дальнего красного света на активность сукцинатдегидрогеназы, свидетельствуют об участии фитохромной системы в регуляции активности сукцинатдегидрогеназы. Это предположение подтверждается отсутствием эффекта ингибирования СДГ красным светом в растениях, дефицитных по гену данного фитохрома.

4. Заключение Таким образом, нами показано, что свет оказывает ингибирующее воздействие на активность сукцинатдегидрогеназы из листьев арабидопсиса и механизм этого ингибирования опосредован через рецепцию красного света с длиной волны 660 нм фитохромом А.

ПРО-ЗАВИСИМЫЙ ФОЛДИНГ И КОНСТРУИРОВАНИЕ ИСКУССТВЕННЫХ ШАПЕРОНОВ Рафиева Л.М., Костров С.В.

Институт молекулярной генетики РАН, 123182 Москва, пл. акад. Курчатова, д.2, Россия rlm80@mail.ru Ключевые слова: протеиназы, про-зависимый фолдинг, SELEX.

1. Введение Во многих случаях корректное формирование пространственной структуры белков проходит в присутствии специальных помощников – шаперонов. В некоторых случаях роль такого помощника может выполнять дополнительная аминокислотная последовательность, отсутствующая в составе зрелого белка, но кодируемая тем же структурным геном. Данное явление получило название про-зависимого фолдинга.

Механизм функционирования про-последовательностей до конца не ясен и активно изучается. Одной из гипотез действия пропептида во время фолдинга является предположение, что он, возможно, фиксирует промежуточные короткоживущие состояния, таким образом, снижая энергетический барьер, отделяющий конечное, нативное, состояние от промежуточного.

Иногда результатом фолдинга является образование альтернативных форм природных белков. Возможно, в ряде случаев, такие явления связаны с возникновением и развитием некоторых нейродегенеративных заболеваний. Исследование механизмов альтернативного фолдинга требует разработки специальных моделей.

Удобной моделью для изучения про-зависимого фолдинга и связанного с ним конформационного разнообразия белков служат бактериальные протеолитические ферменты и, в частности, термолизин-подобные бактериальные металлопротеиназы.

Имеющиеся литературные данные и последние результаты, полученные в нашей лаборатории, дают основания полагать, что про-зависимый фолдинг не просто является одним из механизмов формирования корректной пространственной структуры белков, но, в ряде случаев, позволяет сформировать на базе одной и той же первичной структуры конформационно различные молекулы.

Ранее в лаборатории белковой инженерии ИМГ РАН был клонирован, охарактеризован и экспрессирован в клетках B. subtilis ген термолизин-подобной металлопротеиназы Thermoactinomyces sp. (Th.sp.), формирование пространственной структуры которой проходит по про-зависимому механизму.

Целью данной работы является изучение возможности формирования функционально различных конформационных вариантов металлопротеиназы Th.sp. при проведении фолдинга с использованием различных природных и искусственных фолдинг-ассистентов.

2. Методы 2.1. Экспрессия целевых белков. Экспрессия осуществлялась в клетках штамма-продуцента E. coli BL-21, трансформированных сконструированными нами плазмидами. При этом нами были получены высокоэффективные рекомбинантные продуценты предшественника металлопротеиназы Th.sp., изолированной зрелой части этого белка и его индивидуального пропептида, а также пропептида родственной металлопротеиназы B. amiloliquefaciens. Все эти белки находились большей частью в составе тел включения.

Их экстракцию проводили буфером, содержащим 8 М мочевины.

2.2. Фолдинг полноразмерного предшественника металлопротеиназы Th.sp. проводили 10-кратным разбавлением фолдирующим буфером, содержащим 10 мМ трис-HCl (pH 7,2), 5 мМ CaCl2 и 0,5 мМ ZnSO4.

Протекание реакции контролировали по измерению протеолитической активности (1).

2.3. Фолдинг изолированной зрелой части металлопротеиназы Th.sp. проводили с добавлением пропептида при их молярном соотношении 1:10. Денатурирующий агент удалялся 10-кратным разбавлением фолдирующим буфером. Протекание реакции контролировали по измерению протеолитической активности.

2.4. Очистка целевых белков. В ходе данной работы были применены следующие способы очистки целевых белков: металл-хелат аффинная хроматография (МХАХ) на Ni-НТК-агарозе, ионообменная хроматография (ИОХ) на карбоксиметилцеллюлозе, гель-проникающую хроматографию на колонке Superdex 75 HR, аффинная хроматография на бацитрацин-сефарозе (2).

2.5. Отбор оцДНК-аптамеров к металлопротеиназе Th.sp. Комбинаторная ДНК-библиотека с рандомизированной областью размером 32 нуклотида была любезно предоставлена Л.В. Кульбачинским (ИМГ РАН). Количество белка-мишени и ДНК варьировалось от 100 пмоль и 2.5 нмоль, соответственно, в первом раунде отбора до 100 пмоль и 250 пмоль в последующих раундах. Перед 1, 4 и 10 раундами 10 пмоль оцДНК метили с помощью [32P]ATP[P] (3000 Сi·mmol-1) Т4 полинуклеотид киназой, чистили в 10% денатурирующем ПААГ и добавляли к олигонуклеотидной фракции для визуализации процесса отбора. Раствор оцДНК пропускали через Ni-НТК-агарозу, после чего инкубировали с белком-мишенью в течение 30 мин. при комнатной температуре. Полученную смесь инкубировали с Ni-НТК-агарозой в течение 60 мин. при 4 °С.

Сорбент отмывали от несвязавшейся оцДНК 3-4 раза (общее время 15-30 мин), после чего проводили элюцию буфером, содержащем 250 мМ имидазола. Комплекс белок-ДНК обрабатывали 1 раз смесью фенол хлороформ-изоамиловый спирт (25:24:1) и 2 раза хлороформом, после чего оцДНК осаждали этанолом, растворяли в воде и амплифицировали с использованием Tag-Pol. и соответствующих праймеров:

5’-GGGAGCTCAGAATAAACGCTCAA-3’ и 5’-BBB-GATCCGGGCCTCATGTCGAA-3’, где ВВВ – три молекулы биотина. В дальнейшем мы также использовали праймер, в котором 2 остатка биотина были заменены на 6 остатков полиэтиленгликоля. Цепи ДНК разделяли в денатурирующем 10% ПААГ, небиотинилированную цепь ДНК использовали в следующем раунде отбора.

2.6. Отбор РНК-аптамеров к металлопротеиназе Th.sp. РНК-библиотека была получена с помощью реакции транскрипции с ДНК-библиотеки. Соотношение РНК и белка-мишени варьировалось в пределах от 5:1 до 10:1 при различных условиях. Сам эксперимент в целом аналогичен описанному выше. С РНК, полученной после отбора, ставилась реакция обратной транскрипции для получения кДНК, которая в дальнейшем амплифицировалась.

3. Результаты и обсуждение Фолдинг металлопротеиназы Th.sp. был проведен в двух вариантах. Вариант in cis заключался в ренатурации полноразмерного предшественника данной протеиназы путем разбавления фолдирующим буфером. Вариант in trans осуществляли, проводя фолдинг изолированной зрелой части металлопротеиназы Th.sp. в присутствии несвязанной с ней ковалентно про-последовательности. Стоит отметить, что изолированная зрелая часть металлопротеиназы в условиях данного эксперимента не способна формировать функционально активный фермент. Также необходимо отметить, что гомология зрелых металлопротеиназ Th.sp. и B. amyloliquefaciens составляет 52%, а их про-последовательностей всего 27%. Но при этом, в присутствии гетерологичного пропептида данная металлопротеиназа сворачивалась в функционально активный белок. Была проанализирована субстратная специфичность ферментов, полученных в разных системах – in cis и in trans. При этом были использованы стандартные синтетические пептидные хромогенные субстраты металлопротеиназ DNP-Ala-Ala-Leu-Arg, DNP-Ala-Ala-Phe-Arg и DNP-Ala-Ala-Val-Arg, отличающиеся природой аминокислотного остатка в положении Р1’ (подчеркнуто). Результатом явилось получение различных изоформ металлопротеиназы Th.sp., полученных на базе одной и той же аминокислотной последовательности и различающихся по своей субстратной специфичности.

Далее эта протеиназа использовалась нами в качестве мишени при отборе ДНК- и РНК-аптамеров методом SELEX.

Полученная на данный момент обогащенная олигонуклеотидная фракция имеет невысокую константу связывания, выше 2.5 мкМ. В то же время, имеющиеся литературные данные позволяют нам надеяться получить аптамеры с более высокой аффинностью – в пределах 1 мкМ.

Параллельно ведется подбор условий для отбора РНК-аптамеров.

Литература (1) Charney J., Tomarelli R.M. Determination of the proteolytic activity of duodenal juice. // 1947. J. Biochem. 177: 501-505.

(2) Stepanov V.M., Rudenskaya G.N., Gaida A.V., Osterman A.L. (1981) J. Biochem. Biophys. Methods, 5, 177-186.

ВОЗМОЖНОСТИ ИСПОЛЬЗОВАНИЯ ДЕНДРОХРОНОЛОГИЧЕСКОЙ ИНФОРМАЦИИ ПРИ ИЗУЧЕНИИ ФАКТОРОВ ФОРМИРОВАНИЯ УРОЖАЯ ДРЕВЕСИНЫ Румянцев Д.Е.

Московский Государственный Университет Леса, 141005 Московская область, г. Мытищи ул 2ая Институтская д,1, Россия landgraph@list.ru Ключевые слова: дендрохронология, лесное хозяйство, биопродуктивность Исторически дендрохронологический метод развивался сообразно с потребностями климатологии и археологии, для решения лесоводственных задач он применялся несистематично (Битвинскас, 1974). Так в исследованиях наиболее авторитетных дендрохронологов советской научной школы традиционным объектом являлись насаждения в экстремальных условиях произрастания, например лесотундровые экосистемы (Ловелиус, 1979;

Шиятов, 1986;

Ваганов, Шиятов, Мазепа, 1996;

Мазепа, 1998), не представляющие интереса с точки зрения хозяйственной практики. Закономерности роста в районах интенсивного ведения лесного хозяйства дендрохронологически были гораздо менее исследованы, но следует отметить, что данная тематика была приоритетной для исследований ряда ученых (Битвинскас, 1974;

Молчанов, 1976;

Таранков, 1996;

Феклистов, Евдокимов, Барзут, 1997;

Демаков, 2000, Матвеев, 2004). В настоящее время актуальна систематизация имеющегося отечественного и зарубежного опыта использования дендрохронологической информации, модификация существующих методов ее использования сообразно с задачами лесного хозяйства;

а также разработка новых подходов, могущих быть полезными для решения теоретических и прикладных задач в различных отраслях науки о лесе. Перспективы использования дендрохронологической информации в лесном хозяйстве мы сводим к четырем, на наш взгляд основным направлениям:

1. Исследование факторов формирования урожая древесины 2. Исследование биоразнообразия лесных экосистем 3. Реконструкция истории лесных фитоценозов 4. Оценка состояния здоровья деревьев и древостоев С хозяйственной точки зрения изучение факторов формирования урожая древесины наиболее важно.

Прежде чем рекомендовать расширенное использование дендрохронологических методов в стационарных исследованиях биопродуктивности лесных пород необходимо быть уверенным, что колебания ширины годичного кольца на высоте 1,3 м (стандартное место отбора дендрохронологических образцов) действительно могут служить индикатором колебаний в накопления урожая древесины. Возможно допустить, что падения прироста фиксируемые на материале данных хронологий не всегда отражают падений в продуктивности, ведь спад прироста на высоте 1,3 м может быть компенсирован всплеском в более высоких частях ствола. Решение задачи оценки изменчивости радиального прироста на высоте 1,5 м как показателя общей продуктивности дерева нами проведено на материале подпологового возобновления ели в культурах сосны. Было установлено, что хронологии по радиальному приросту в основном характеризуются отрицательным трендом, тогда как хронологии по объемному приросту в данном возрасте все еще имеют положительный тренд. В исследованиях посвященных вопросам биопродуктивности часто используется такой показатель как тренд радиального прироста (Алексеев, Сорока, 2002;

Гутников, Страхова, 2002;

Шишов, Рубцов, Плешков, 2003). Приведенные данные свидетельствуют о том, что тренды радиального прироста могут не совпадать (и для наименее угнетенной части древостоя, как правило, не совпадают) даже по знаку с трендами объемного прироста. Более наглядно это можно отметить при сопоставлении хронологий для одного учетного дерева. Это наблюдение дает основания быть более осторожными в использовании результатов исследований биопродуктивности полученных главным образом на базе трендов радиального прироста.

Кратковременная изменчивость величины прироста была выделена из индивидуальных хронологий сглаживанием с помощью симметричной пятилетней скользящей средней. Сопоставление хронологий (таблица) показало, что у модельных деревьев колебания радиального прироста на высоте 1,5м соответствуют колебаниям объемного прироста, тогда как динамика индексов линейного прироста существенно отлична.

Таблица. Значения коэффициентов корреляции между индексированными временными рядами по разным видам прироста.

Вид прироста Радиальный Объемный Линейный Радиальный 1 _ Объемный 0,91 1 Линейный 0,37 0,52 Одной из актуальных задач для лесного хозяйства является прогноз динамики продуктивности под влиянием колебания погодных условий. Одной из наиболее обстоятельных современных моделей, описывающих влияние климатических факторов на формирование годичных колец древесины, является экофизиологическая имитационная модель, предложенная Е.А. Вагановым и А.В. Шашкиным (Ваганов, 1996;

Ваганов, Шашкин, 2000). Вместе с тем, как отмечают авторы, информация о процессах роста размеров трахеид и синтезе их клеточных стенок имеет в основном качественный характер и данных о динамике этих процессов еще очень мало. Поэтому для решения практических задач, часто могут быть полезны эмпирические модели роста годичных колец. При разработке эмпирических моделей не ставиться целью связать величину прироста с первичными процессами роста, а ставится целью лишь адекватное описание изменчивости прироста на основе данных о колебании погодных условий.

В настоящее время закономерности климатической изменчивости в районах интенсивного ведения лесного хозяйства изучены сравнительно слабо. Дело в том, что дендроклиматический анализ роста в неэкстремальных условиях затруднен, так как лимитирующие прирост факторы меняются от года к году. Если в данном году увеличение продуктивности ограничивается недостатком дозы фактора A, то на следующий год при тех же значениях фактора А прирост может лимитироваться уже недостатком дозы фактора B. Перспективным методом для ведения дендроклиматичксого анализа в высокопродуктивных насаждениях нам видится сопряженный анализ хронологий. Идея его проста: если величина прироста у нас определяется уравнением с множеством независимых переменных, то составив систему уравнений, мы можем в отдельных случаях (в отдельные годы) найти решения этих уравнений. Для сопряженного анализа необходимо подбирать хронологии, потенциально отличающиеся по содержащемуся в них климатическому сигналу. Так в условиях Порецкого лесничетва Бородинского лесхоза нами изучался рост лиственницы европейской (Larix decidua Mill.), породы способной формировать в условиях Подмосковья насаждения максимального запаса. Ее древесина обладает своеобразными техническими свойствами, поэтому может иметь сбыт даже при условии обилия на рынке древесины сосны и ели. С привлечением хронологии по лиственнице сибирской, произрастающей в хорошо дренированном экотопе было установлено, что в условиях Западного Подмосковья для лиственницы европейской не существует климатического фактора, который бы постоянно лимитировал величину прироста. Так, снижение прироста лиственницы европейской может быть обусловлено как недостатком увлажнения почвы, так и его избытком. Температурный режим Западного Подмосковья благоприятен для роста лиственниц и мало влияет на колебания прироста стволовой древесины, только экстремальные (максимальные и минимальные) отклонения среднемесячных летних температур от среднемноголетней нормы сказываются на ширине годичных колец. В условиях неопределенности температурного режима будущих десятилетий лиственница является одной из наиболее перспективных пород для лесовозобновления в условиях Подмосковья.

Для сопряженного анализа хронологий были также привлечены индексированные ряды прироста по ранней и по поздней древесине, так как предполагалось, что хронологии по ранней и по поздней древесине будут содержать разный климатический сигнал. Однако оказалось что данные ряды практически идентичны (R0.7). Отметим, что тесная связь колебаний поздней древесины с колебаниями ранней древесины была также найдена Эклундом (1957) для ели европейской. Таким образом, в нашем случае, соотношение ранней и поздней древесины в годичном кольце л. европейской с точки зрения дендроклиматического анализа оказалось малоинформативным показателем.

Благодарность Работа выполнена при поддержке РФФИ (грант № 05-04-48614).

СОЗДАНИЕ И АНАЛИЗ РАСТЕНИЙ-ПРОДУЦЕНТОВ БЫЧЬЕГО ГАММА-ИНТЕРФЕРОНА Савельева Н.В., Дудник Е.Э.

Санкт-Петербургский государственный университ, 199034 Санкт-Петербург, Университетская наб. 7/ Ключевые слова: биотехнология, ветеренария, растения-продуценты, иммуностимуляторы, гамма-интерферон Проблема создания безопасной биотехнологической системы, легко применимой для получения фармакологических соединений в промышленности и сельском хозяйстве давно стоит перед учеными. В связи с легкостью культивирования, высокой скоростью роста и низкой себестоимостью биомассы, использование растений в качестве биореакторов приобретает всё более широкое распространение в современной биотехнологии. Мы планируем разработать биотехнологическую растительную систему, синтезирующую бычий гамма-интерферон. Такие растения-продуценты возможно будет использовать как “растения-вакцины”, добавляя их в корм молодым бычкам для стимуляции иммунитета. Это одна из первых работ в данной области ветеринарии, которые проводят в России.

При изучении регуляции клеточного и гуморального иммунного ответа была открыта большая группа медиаторов белковой природы, названных цитокинами. Сейчас известно более 30 цитокинов, важнейшее место среди которых принадлежит интерферонам. Эти белки синтезируются большинством эукариотических клеток в ответ на различные антигены вирусной и невирусной природы. Несмотря на противовирусную активность, интерфероны применяются как иммуностимуляторы для лечения и профилактики различных паразитарных заболеваний и злокачественных новообразований. До сих пор существующие способы получения интерферонов являются малоэффективными и небезопасными. Препараты первого поколения, получаемые из донорской крови, экономически не выгодны из-за дефицитности сырья и дороговизны конечного продукта, более того, существует опасность его контаминации животными вирусами.

Предложенный путь биосинтеза интерферонов в бактериях был отвергнут из-за неправильной пространственной укладки эукариотического белка. В середине 80-х годов, при помощи генной инженерии удалось наладить широкомасштабное производство интерферонов с использованием культур клеток дрожжей и создать рекомбинантные препараты нового поколения. Данная система достаточно эффективна, но получаемый с ее помощью препарат требует дорогостоящей очистки. Использование растений – продуцентов бычьего гамма-интерферона позволит сэкономить на очистке биопрепарата и ежегодной вакцинации животных.

В настоящее время с помощью биотехнологии создан ряд запатентованных биопрепаратов для повышения неспецифического иммунитета животных, содержащих видоспецифичный интерферон. В частности это препарат для профилактики вирусных болезней свиней, содержащий свиной лейкоцитарный альфа интерферон и препарат для профилактики вирусных респираторных заболеваний крупного рогатого скота, содержащий бычий альфа-интерферон. Но наиболее перспективным представляется создание трансгенных растений - продуцентов интерферонов, которые возможно добавлять непосредственно в корм животным, минуя дорогостоящую очистку.

Применение в животноводстве интерферонов, и гамма-интерферона в частности, имеет существенные преимущества по сравнению с традиционными антибиотиками и химиотерапевтическими препаратами.

Областью применения гамма-интерферона является лечение и профилактика вирусных, онкологических, а также вызываемых бактериями заболеваний. Например, гамма-интерферон является ключевым цитокином в защитном иммунном ответе на микобактерию (Mycobacterium tuberculosis bovis), и является доминирующим в экспрессии антигенов к туберкулезной инфекции крупного рогатого скота. Кроме того, гамма-интерферон является противоопухолевым агентом, а учитывая, что вирусный лейкоз является широко распространенным заболеванием крупного рогатого скота, необходимость подобного лекарственного средства для ветеринарии не вызывает сомнения.

Данная работа предполагает использовать широкий спектр современных методов работы с растительными культурами и бактериальными штаммами в условиях in vitro, а так же использовать новейшие методы молекулярной биологии и генной инженерии. Разработка высокоэффективных и оптимальных по времени методов агробактериальной трансформации для сельскохозяйственных культур гороха и моркови будет новым шагом в этой области исследований.

Наши исследования предполагалось проводить в несколько этапов. Первый этап исследований состоял в создании адекватной модели, на которой возможен быстрый анализ поведения гетерологичного гена гамма интерферона. В настоящий момент коллектив создал уникальную растительную модельную систему на основе трансгенных растений табака для изучения наследования, экспрессии и накопления бычьего гамма интерферона. Нами получена серия трансгенных растений табака поколения Р0 и проведен анализ экспрессии гена гамма-интерферона быка в этих растениях. Мы показали недостаточный уровень экспрессии чужеродного гена в растениях табака поколения Р0. От данных трансгенных растений мы заложили серию линий.

Дальнейшие исследования растений поколения Р1 показали, что целевой ген стабильно наследуется в поколении более, чем в 60% случаев. Кроме того, мы провели сложную подготовку материала для анализа экспрессии гетерологичного белка в растениях поколения Р1. В последствии трансгенные растения поколения Р1 были высажены в почву и от них получен семенной материал для дальнейших исследований растений поколения Р2. Таким образом, к настоящему моменту мы имеем оригинальные данные о наследовании гена бычьего гамма-интерферона и его экспрессии в модельной растительной системе.

Следующим этапом наших исследований стал подбор оптимальных сортов моркови и гороха, которые можно было бы взять в качестве основы для создания растений-вакцин. Мы провели трудоемкую подготовительную работу по подбору оптимальных сред и условий культивирования для культур гороха и моркови в условиях in vitro. Далее, мы осуществили агробактериальную трансформацию данных культур, используя 6 методов, включающих как методы in vitro, так методы in vivo. Выявленная в процессе работы сортоспецифичность на данный момент не позволила оценить в полной мере эффективность различных методик агробактериальной трансформации. Поэтому необходимо провести скрининг сортов по эффективности разных методов трансформации. Однако, первичная оценка полученных нами результатов показывает, что наиболее эффективным для обеих культур является разработанный нами метод трансформации проростков in planta в условиях in vivo (70 – 80% трансформации в поколении Р0). Такие исследования являются уникальными, и, по-видимому, вызовут интерес у научной общественности всего мира, так как проблемы последних этапов трансформации гороха до сих пор еще не решены, а трансформация моркови представляет сложный, трудоемкий и низкоэффективный процесс. С другой стороны, разработка биотехнологических методов для моркови и гороха очень актуальна, так как они входят в число широко распространенных сельскохозяйственных культур и в России, и в ряде других стран.

Заключительным этапом будет тестирование полученных растений на лабораторных животных, чтобы оценить качество и возможность применения данного продукта наших исследований в животноводстве.

Помимо этого, основываясь на данных предварительных экспериментов по эффективности трансформации, мы предлагаем в качестве основы для создания “съедобных вакцин” для культуры гороха взять сорт Амброзия, а для культуры моркови использовать сорта Нантская и Роте Ризен.

Учитывая все выше изложенное, коллектив имеет достаточный научный задел, который позволит в настоящий момент перейти к решению главной задачи – созданию “растений-вакцин” на основе сортов Нантская и Роте Ризен (морковь) и Амброзия (горох).

РАЗРАБОТКА БИОПРЕПАРАТОВ НА ОСНОВЕ БИОКОНТРОЛЬНЫХ ШТАММОВ TRICHODERMA С ИСПОЛЬЗОВАНИЕМ РАСТИТЕЛЬНЫХ ОТХОДОВ ТЕХНОГЕННОЙ СФЕРЫ Садыкова В.С.

Сибирский государственный технологический университет, 660049, Красноярск пр. Мира 82, Россия Ключевые слова: биоконтроль, твердофазная ферментация, грибы рода Trichoderma, растительные субстраты, лесные питомники Причиной в возникновении локальных заболеваний и эпифитотий в лесопитомниках Средней Сибири являются фитопатогенные микромицеты. Основной ущерб выращиванию лесопосадочного материала наносит инфекционное полегание, вызываемое грибами родов Fusarium, резервуар инфекции которых сохраняется длительный период в почве и на семенах. Хорошая обеспеченность почв лесопитомников гумусом, благоприятный уровень рН создают условия для ежегодного развития болезней сеянцев хвойных.

Широкое и успешное использование для биологической защиты растений против грибных возбудителей болезней получили грибы рода Trichoderma. В частности, виды Trichoderma harzianum, Trichoderma virens, и Trichoderma hamatum используются в защите растений от широкого спектра заболеваний.

Однако стандартные «музейные» штаммы, использующиеся в сельском хозяйстве для защиты растений, не всегда эффективны при интродукции их в лесные питомники, а результаты полевых и вегетационных опытов не совпадают. Одной из причин этого является то, что в естественных условиях климатические условия и конкурентные взаимодействия с аборигенной почвенной микрофлорой начинают играть ведущую роль. Это вызывает необходимость предварительного отбора активных штаммов со стабильными признаками среди аборигенных изолятов рода Trichoderma и последующую их селекцию.

С этой целью была исследована коллекция из 197 аборигенных штаммов Trichoderma (T.asperellum, T.viride, T.harzianum, T.koningii, T.virens), на антагонистичекую активность по отношению к фитопатогенам рода Fusarium, вызывающим полегание сеянцев хвойных в Средней Сибири. Скрининг штаммов позволил отобрать 15 аборигенных штаммов как потенциальных биоконтрольных агентов. Штаммы, показавшие лучшие результаты, были оценены на антибиотические и микопаразитические свойства в условиях светокультуры и мелкоделяночных опытах в лесных питомниках.

Изменчивость грибов является серьезным препятствием при использовании штаммов в биотехнологии и разработке биометода. Многие активные штаммы грибов при неблагоприятных условиях хранения и культивирования теряют свои свойства и вытесняются низкопродуктивными формами. Это вызывает необходимость проведения предварительного отбора среди активных штаммов со стабильными признаками и последующей его тщательной селекции.

Проведенные исследования моноспоровых клонов 15 природных изолятов показали высокую гетерогенность по культурально-морфологическим признакам, скорости роста и интенсивности спороношения, что имеет большое значение при отборе штаммов-продуцентов для производства биопрепаратов. На основании перечисленных признаков, все изоляты вида разделялись на четыре культурально-морфологических группы. Вегетативная совместимость изолятов коррелирует с этими группами. Изучаемые сибирские штаммы Т. asperellum, проявляли гетерогенность по антибиотической активности в отношении видов рода Fusarium. Максимальную антибиотическую активность проявляли клоны второй группы, которые оказались наиболее продуктивными и сохраняли свои первоначальные признаки в нескольких пассажах. Изоляты этой группы проявляли реакции несовместимости с клонами, относящимися к другим группам. На основании вышеперечисленных данных были отобраны четыре наиболее антагонистически активных и стабильных моноспоровых штамма: МГ-6, К-12, 01-00, 10-99/5.

Для подбора дешевых и экологически чистых субстратов в производстве биопрепаратов была проведена оценка способности роста и утилизации отходов деревоперерабатывающей и гидролизной промышленности отобранных штаммов грибов рода Trichoderma. В качестве субстратов использовали: гидролизный лигнин, кору ели, твердый остаток коры ели после углекислотной экстракции, твердый остаток коры ели после углекислотной и спиртовой экстракции, твердый остаток коры ели после углекислотной и водной экстракции, кору лиственницы, одубину коры лиственницы.

Для испытаний отобранных штаммов грибов рода Trichoderma были наработаны опытные партии биопрепаратов, полученные путем твердофазной ферментации на коре пихты и на коре ели после углекислотной экстракции штамма МГ 97/6 Trichoderma asperellum, с титром 3·108 спор в 1 грамме препарата.

В состав комплексного препарата на коре пихты вошли штаммы МГ–97/6 Trichoderma asperellum, М 99/ Trichoderma harzianum, K-12 Trichoderma asperellum, МО Trichoderma hamatum с титром 2,5·108 спор в грамме препарата. Результаты исследований показали, что при обработке семян и посевов Picea obovata L.

биологическими препаратами увеличивается выход здоровых сеянцев Picea obovata L. в сравнении с контролем: при внесении чистого спорового биопрепарата триходермин-с в 1,6 раза;

триходермина, полученного на коре лиственницы – в 4 раза;

триходермина, полученного на коре ели после углекислотной экстракции – в 3,4 раза. Наибольший выход сеянцев получен в варианте с использованием комплексного препарата на основе 4 штаммов МГ–97/6 Trichoderma asperellum, М 99/5 Trichoderma harzianum, K- Trichoderma asperellum, МО Trichoderma hamatum. Выход сеянцев в этом варианте в 8,5 раза выше, чем в контрольном варианте.

Выход спор, (М±m), *108 *г- № Субстрат п/п МГ/6 К-12 10 - 99/5 МО 1 гидролизный лигнин 0,65±0,04 0,13±0,03 0,85±0,01 0,19±0, 2 кора ели 2,34±0,06 1,79±0,01 2,29±0,04 1,53±0, 4 твердый остаток коры ели после СО2- экстракции 3,57±0,02 3,57±0,02 2,40±0,03 2,14±0, твердый остаток коры ели после СО2- и спиртовой 2,58±0, 5 2,79±0,01 3,75±0,03 2,53±0, экстракции твердый остаток коры ели после СО2- и водной 2,65±0, 7 2,20±0,06 2,37±0,02 2,38±0, экстракции 3 кора лиственницы 1,90±0,01 1,21±0,03 1,81±0,03 1,33±0, 6 одубина коры лиственницы 2,90±0,01 1,51±0,03 2,67±0,03 1,83±0, К л ч с в с я ц в ш.

о и ет о ен е, т 1 2 3 4 Варианты опыта Рисунок - Выход сеянцев Picea obovata L. на 1 м погонный в лесном питомнике при обработке посевов биопрепаратами 1 - контроль, 2 - триходермин-с, 3 - триходермин на коре лиственницы, 4 -триходермин на коре ели после углекислотной экстракции, 5 - комбинированный биопрепарат Полученные данные наглядно свидетельствуют о том, что применение биопрепаратов, полученных на растительных субстратах, более эффективно по сравнению с использованием споровых биопрепаратов.

Вероятнее всего это связано с тем, что растительные субстраты являются источником дополнительных питательных веществ и стимулируют еще более интенсивное развитие грибов рода Trichoderma в почве ризосферы сеянцев Picea obovata L.

Анализ микрофлоры почвы ризосферы сеянцев Picea obovata L. Мининского лесопитомника показал, что внесение биопрепаратов на основе сибирских антагонистически активных штаммов грибов рода Trichoderma оказывало оздоравливающее действие на микробоценоз. Интродуцированные штаммы изменяют структуру микобиоты, подавляя фитопатогены и увеличивая долю сапротрофных видов. При внесении наблюдается снижение численности азотфиксаторов, в то время как численность бактерий, способные усваивать минеральный азот, возрастает.

ОЦЕНКА ЭФФЕКТИВНОСТИ ИСПОЛЬЗОВАНИЯ СОЛНЕЧНОЙ ЭНЕРГИИ ПРИ СИНТЕЗЕ БИОЛОГИЧЕСКОЙ ПРОДУКЦИИ ПО МУЛЬТИСПЕКТРАЛЬНОЙ ДИСТАНЦИОННОЙ ИНФОРМАЦИИ Сандлерский Р.Б., Пузаченко Ю.Г. Московский государственный университет им. М.В. Ломоносова Географический факультет 119899, Москва, Ленинские горы Институт проблем экологии и эволюции им. А.Н. Северцова, РАН, 119071 Москва, Ленинский пр. 33.

srobert_landy@mail.ru Ключевые слова: энергия, эксергия, продуктивность, растительность 1. Введение Для интенсификации лесного и сельского хозяйства полезно совершенствовать оценки чистой биологической продуктивности, доли солнечной энергии, затрачиваемой на транспирацию и собственно продукцию, как без учета, так и с учетом типа местообитания. Под местообитанием в этом контексте понимается совокупность почвенных свойств и свойств рельефа, влияющих на соотношение затрат энергии на продукцию и транспирацию. Получить такие оценки на основе наземных измерений практически невозможно.

Они возможны на основе дистанционных мультиспектральных измерений отраженной солнечной радиации, позволяющей рассчитать составляющие энергетического баланса конкретных участков земной поверхности.

Предлагаемый подход может быть использован для повышения экономической эффективности использования возобновимых биологических ресурсов.

2. Материалы и методы В основе предлагаемого подхода лежит представление об эксергии (“exergy”) – максимальной работе, которую может совершить термодинамическая система при переходе из данного состояния в состояние равновесия со средой. Эксергией иногда называется работоспособность системы. Применительно к ландшафтному покрову эксергия – поглощенная солнечная энергия, идущая на продуктивность и эвапотранспирацию. Измерение эксергии по мультиспектральной съемке осуществляется через дистанцию между распределением мощностей по спектру поглощенной солнечной энергии для единицы поверхности и равновесным состоянием, с гипотетическим поглощением солнечной энергии пропорционально распределению мощностей в спектре солнечной постоянной. Степень отклонения реального спектра поглощения от равновесного оценивается как энтропия Кульбака (K) (1):

К = pioutln(piout/piin), где piin / piout – доля поступившей / отраженной энергии в канале i от суммарной поступившей / отраженной энергии.

Энтропия Кульбака – мера различия двух сравниваемых распределений и параметр открытых неравновесных термодинамических систем.

Эксергия (Ex), оцениваемая через энтропию Кульбака Ех = Еout(K+ln(Eout/Ein))+R, где E – суммарный приход энергии, Еout – суммарное отражение энергии, R – суммарная поглощение in энергия.

Величина эксергии дает представление об энергетических затратах на транспирацию и продуктивность.

Для оценки непосредственных затрат энергии на продукцию можно использовать соотношение отраженной энергии в красном (RED) и ближнем инфракрасном диапазонах (NIR), лежащее в основе расчета распространенного параметра NDVI (Normalized Difference Vegetation Index) (4).

Соответственно отношение разности отраженной энергии в ближнем инфракрасном и красном диапазонах к эксергии позволяет оценивать долю энергии, затраченной на производство биологической продукции (NPP%):

NPP%=100(NIR-RED)/Ex Информативность предлагаемых оценок рассмотрена на примере территории Центрально-Лесного биосферного заповедника и его охранной зоны – 32°53’ В.Д., 56°46’ С.Ш.. Ландшафт заповедника: моренно грядовая возвышенность с темнохвойными неморальными и бореальными естественными лесами, в сочетании с лесными и верховыми болотами, ветровалами, вырубками, разновозрастными вторичными лесами и используемыми и заброшенными полями и лугами. На этой территории проведено более 1000 полевых описаний состояния растительности, гранулометрического состава почвообразующих пород, мощности почвенных горизонтов и их окраски по шкале Манселла, так же построена на основе топографической карты масштаба 1:10000 цифровая модель рельефа. Разнообразие территории и обеспеченность ее полевыми измерениями позволяет хорошо тестировать физический смысл полученных оценок энергетического баланса.

Составляющие энергетического баланса рассчитаны по спектрозональной съемке Landsat 5, 7 с разрешением 28.5 м, для пяти сроков: 22 марта 2001 г, 27 апреля 2000 г, 3 мая 1990 г, 20 июня 2002 г, 27 сентября 2000 г.

Спутники снимают эту территорию в 11 часов 30 мин по московскому времени. В это время суток обычно наблюдается наиболее интенсивный фотосинтез.

3. Результаты и обсуждение Таблица 1: Составляющие энергетического баланса в целом для территории Переменные апрель май июнь сентябрь Общая поглощенная энергия (R), Вт/м2 1435.93 1426.97 1613.04 1008. Эксергия (Ex), Вт/м2 1126.44 1150.42 1257.04 789. Затраты на чистую продукцию, NPP%% 1.7 1.4 4.5 2. Полученные общие оценки затрат энергии на чистую продукцию (Табл.1) не противоречат существующим представлениям. На чистую продукцию по различным оценкам идет 0.1 – 0.2% эксэргии солнечной радиации (2, 3). Ю.М. Свирежев (1) приводит для умеренных широт среднюю оценку доли энергии идущей на NPP – 0.9%. Полученная средняя оценка для июня – 4.5%, что вполне приемлемо для времени наблюдения с максимальным фотосинтезом.

На основе регрессионного анализа установлено, что возраст, запас и состав леса определяет для июня 37% варьирования NPP% и 27% Ex. В полном соответствии с общими представлениями NPP% старых лесов минимально, а Ex максимальна. Хвойные породы при прочих равных условиях имеют большую Ex и меньшее NPP%. Значения и соотношение Ex и NPP% позволяют с высокой надежностью, с разрешением 60х60 м на местности, определить запасы древесины и оптимальный возраст рубки.

Свойства макро, мезо и микрорельефа без учета растительности описывают 15% варьирования NPP%, что позволяет построить карту потенциальной продуктивности как результата перераспределения влаги и тепла рельефом (рис. светлый тон – максимальное потенциальное NPP). Регрессионный анализ показывает, что NPP% статистически надежно определяется также гранулометрическим составом почв, мощностью гумусового и подзолистого горизонтов и степенью окислительного процесса. Для лесных территорий почва описывает 17% варьирования NPP, для сельскохозяйственных – 27%. Состояние растительности надежно воспроизводиться через рельеф, каналами дистанционной съемки. В результате выделяется собственный вклад в NPP типа местообитания.

Использование сцен за разные сезоны года позволяет оценить длительность периода вегетации на различных элементах рельефа и почвах. В целом предлагаемая технология позволяет оценить текущую и потенциальную биологическую продуктивность любой территории и с определяемой точностью оценить качество земель и на этой основе определить наиболее эффективные формы их использования.

Благодарность Авторы выражают признательность Д.Н. Козлову за помощь в подготовке данных и обсуждение, И.П. Котлову за помощь в переводе.

Литература (1) Jorgensen S.V., Svirezhev Y. M. Towards a Thermodynamic Theory for Ecological Systems – Elsevier Ltd. The Boulevard, Oxford UK, 2004. – 369 p.

(2) Hall D. O. and Rao K.K., Photosynthesis, 6th Edition, Studies in Biology, Cambridge University Press (3) Бродянский В., Бандура А. Ресурсы ноосферы и экономика//Энергия № 10, 1996. С. 12 – (4) Пузаченко Ю.Г., Санковский А.Г. Климатическая обусловленность чистой продукции биосферы Известия РАН сер. Географ. 5, 2005. С. 14 – ИЗУЧЕНИЕ ВЛИЯНИЯ ПРОНЕЙРОТРОФИНОВ НА ВОЗНИКНОВЕНИЕ И РАЗВИТИЕ НЕВРОЛОГИЧЕСКИХ ЗАБОЛЕВАНИЙ ЧЕЛОВЕКА.

Сафина Д.Р.

Институт молекулярной генетики РАН. 123182 г. Москва, пл. Курчатова, д.2, Россия nauruz@mail.ru Ключевые слова: неврологические заболевания человека, нейротрофины, пронейротрофины, про-зависимый фолдинг, фолдинг-ассистенты, иммуноферментный анализ, тест-системы.

1. Введение Данная работа направлена на разработку подходов для исследования вовлеченности в патогенез неврологических заболеваний человека предшественников нейротрофинов.

Нейротрофины являются гуморальными факторами, осуществляющими биохимическую регуляцию развития и функционирования нервной системы. При этом нейротрофины могут оказывать самые разнообразные эффекты, такие как повышение жизнеспособности нейронов, влияние на их дифференцировку, митоз или программируемую гибель, модуляцию синаптической пластичности. По-видимому, именно они в значительной степени определяют течение таких заболеваний как ишемический инсульт, болезнь Альцгеймера, Паркинсона и др. У человека известно несколько представителей семейства нейротрофинов:

фактор роста нервов (NGF), нейротрофический фактор головного мозга (BDNF) и нейротрофические факторы 3, 4/5 и 6 (NT-3, NT-4/5, NT-6). Наиболее изученными являются NGF, BDNF и NT-3, которым, в основном, посвящено дальнейшее изложение. В целом нейротрофины человека изучены достаточно подробно. Зрелые формы этих белков не гликозилированы, состоят из 119-121 аминокислотных остатков и имеют уровень гомологии около 55%. Определены трехмерные структуры NGF, BDNF и NT-3. Они близки между собой и протомеры этих молекул относятся к весьма своеобразному семейству, пространственная укладка которых известна как «цистиновый узел». Все известные белки, имеющие подобную укладку функционируют в качестве димеров. Это справедливо и для нейротрофинов, основной функциональной формой которых является гомодимер.

В последнее время в изучении механизмов действия нейротрофинов возникло новое чрезвычайно интересное направление, связанное с исследованием функциональной активности пронейротрофинов. Все перечисленные выше нейротрофины синтезируются в виде протяженных предшественников, которые, кроме сигнального пептида, содержат дополнительную пропоследовательность, размером 105-120 аминокислотных остатков. Пропоследовательность соединена со зрелой частью белка единым для proNGF, proBDNF и proNT- мотивом Arg-X-(Lys/Arg)-Arg. Процессинг предшественника приводит к формированию зрелого нейротрофина и может осуществляться целым рядом пробелокконвертаз, в первую очередь протеиназами, принадлежащими к группе фуринов. Функциональная роль пропоследовательностей нейротрофинов на настоящий момент не установлена. Высказано предположение, что она может выполнять функции фолдинг ассистента и, таким образом, формирование пространственной структуры нейротрофинов происходит по про зависимому механизму. Косвенным подкреплением этого предположения является тот факт, что индивидуальные зрелые части нейротрофинов, по-видимому, не способны сворачиваться в функционально активные молекулы. Недавно было показано, что наряду со зрелыми молекулами в межклеточное пространство секретируются и пронейротрофины. Более того, пронейротрофины оказались функционально активны, а их действие, во многих случаях альтернативно действию зрелого белка. Таким образом, отщепление пропоследовательности не просто является завершающим актом в формировании зрелого лиганда, но может оказаться механизмом, регулирующим функционирование системы нейротрофинов в целом.

В рамках данной работы планируется выполнение следующих задач:

- конструирование рекомбинантных продуцентов модифицированных форм нейротрофина NT-3 человека;

- очистка целевых белков;

- получение зрелых нейротрофинов человека путем фолдинга и процессинга;

- получение антител к целевым белкам;

- разработка иммуноферментного анализа для количественного тестирования пронейротрофинов человека;

- тестирование пронейротрофинов в клинических образцах.

Предполагается использовать разрабатываемый метод иммуноферментного анализа для оценки присутствия пронейротрофинов у больных с ишемическим инсультом и другими неврологическими заболеваниями.

2. Материалы и методы Для получения продуцентов рекомбинантного пронейротрофина NT-3 человека, его индивидуальных пропоследовательности и зрелой части были использованы экспрессионный штамм Escherichia coli BL-21 и векторная плазмида pET23-c. Экстракцию целевых белков из тел включения осуществляли, используя раствор 8М мочевины, в присутствии 30мМ -меркаптоэтанола. Очистку модифицированных форм нейротрофина NT 3 от внутриклеточных белков Escherichia coli BL-21 проводили в две стадии: 1. металлохелат аффинная хроматография на Ni-содержащем сорбенте, 2. гель-проникающая хроматография на колонке Superdex 200HR 10/30 в режиме HPLC. Фолдинг очищенного препарата пронейротрофина проводили в буфере, содержащем 0,1М трис-HCl, pH8.45, 0.75M L-аргинина, 5мМ глутатиона восстановленного, 0.5мМ глутатиона окисленного, 5мМ этилендиаминтетраацетата-Na.

3. Результаты и обсуждение В настоящее время нами клонирован и охарактеризован ген пронейротрофина человека proNT-3 и на основе бактериальной экспрессионной системы сконструирован рекомбинантный продуцент этого белка.

Также получены рекомбинантные продуценты индивидуальной пропоследовательности и зрелой части нейротрофина человека NT-3. Были разработаны схемы очистки и фолдинга пронейротрофина proNT-3, их применение позволило получить рекомбинантный proNT-3 человека. Сейчас нами проводится изучение функциональной активности данного белка, с использованием моделей некротического и апоптотического повреждения клеток окислительным стрессом и депривацией ростовых факторов. На основе антител к рекомбинантному пронейротрофину proNT-3 планируется разработать вариант иммуноферментного анализа для количественного тестирования пронейротрофинов человека в клинических образцах. Предполагается использовать разрабатываемый метод анализа для оценки присутствия пронейротрофинов у больных с ишемическим инсультом и другими неврологическими заболеваниями.

4. Заключение В ходе выполнения данной работы нами предполагается впервые создать эффективные методы анализа пронейротрофинов в клинических образцах и, таким образом, разработать новый подход к анализу сложной сети процессов биохимической регуляции развития и функционирования нервной системы человека в норме и при патологии. В первую очередь данный подход будет использован для анализа динамики биосинтеза пронейротрофинов у больных с ишемическим инсультом. Эти исследования могут прояснить механизмы развития этого тяжелого неврологического заболевания и сформулировать новые подходы к его и лечению. В дальнейшем разработанный метод анализа будет апробирован на больных с другими неврологическими заболеваниями. В ходе выполнения рабты будут сконструированы рекомбинантные продуценты ряда пронейротрофинов человека (proNGF, proBDNF), которые играют ключевые роли в регуляции функционирования нейронов. Эти продуценты и соответствующие белки имеют высокую собственную ценность, в первую очередь как инструменты для исследования регуляторных механизмов функционирования нервной системы.

ФИТАЗА PENICILLIUM CANESCENS Синицына О.А.



Pages:     | 1 |   ...   | 3 | 4 || 6 | 7 |
 





 
© 2013 www.libed.ru - «Бесплатная библиотека научно-практических конференций»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.